SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228410.NE0812 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228410.NE0812
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.78e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 73-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.84e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228410.NE0812
Sequence length 199
Comment (Nitrosomonas europaea)
Sequence
MMTLYSTATCPFSHRCRIVLHEKDMDFQVIDVDPNNIPEDIAVISSYSKVPILVERDLVL
YEANIINEYIDDRFPHPQLMPAEPVMRARARLLLHRFEKELFCHIESLEQGDHKTADKAR
AEIADGLTMIAPIFEKQKYMLGDEYTMLDVAIAPLLWRLDHYGVKLPKQAAPLLKYAERL
FSRPLFIDALTPSEKLMRK
Download sequence
Identical sequences A0A1I0AE88 Q82W82
gi|30248816|ref|NP_840886.1| WP_011111424.1.11244 WP_011111424.1.14462 WP_011111424.1.55826 WP_011111424.1.61914 228410.NE0812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]