SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228410.NE1292 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228410.NE1292
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.67e-33
Family Ribosomal L27 protein 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 228410.NE1292
Sequence length 85
Comment (Nitrosomonas europaea)
Sequence
MAHKKAGGSSRNGRDSHSKRLGVKRYGGEIIRAGGIIVRQRGTQFHPGDNVGIGRDHTLF
AKVDGKIVFAVKGRMNRRTVAVIPS
Download sequence
Identical sequences A0A1H9ZHZ8 Q82V19
228410.NE1292 WP_011111870.1.11244 WP_011111870.1.14462 WP_011111870.1.55826 WP_011111870.1.61914 gi|30249271|ref|NP_841341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]