SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228410.NE1303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228410.NE1303
Domain Number 1 Region: 58-101
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000824
Family Integrin alpha N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 228410.NE1303
Sequence length 163
Comment (Nitrosomonas europaea)
Sequence
MWQTICRGAIAGGVLLLTVQPVSAAEPDPAQVEKTVQAYIGKANQEAAQNRESVEESQVV
TADLNGDGRAEIILWSTRYGGTYSFNDVTIFTDSGRGYQVAAGTEDVLGMVESIEVKNGL
IHIHALWPGPNDPRCCPTVKKTAVYQWQGKALADVTSRVSGKK
Download sequence
Identical sequences A0A1H9ZIU4 Q82V08
228410.NE1303 WP_011111881.1.11244 WP_011111881.1.14462 WP_011111881.1.55826 WP_011111881.1.61914 gi|30249282|ref|NP_841352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]