SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228908.NEQ442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228908.NEQ442
Domain Number 1 Region: 205-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-20
Family Legume lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  228908.NEQ442
Domain Number - Region: 168-208
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00591
Family Fibronectin type III 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 228908.NEQ442
Sequence length 775
Comment (Nanoarchaeum equitans)
Sequence
MRSILALLILGIALSIKIPLLDSLFEFDKNTGEIRIKKLIQDFVKINSTVSLLSNTSIGK
GSKIVIEKGGKLIVPNKNKETIKVKAEYYIEFPIARWIQKVTIHNPNNYAINNYTLIINI
DSKLGKAKELFANSANSELKQYQYFVAFDSKEVLPFCYLDSEGFCTDTVTNKIAVKIDEL
KPGQTYTFYIGLTNKDYSSPPKDVFLFYADFENDINNLASLREYFDVYANNNPCITAWDS
NGLPLTCGGYSQVTTISPKVNISLETPLEIKVKYKAIKIRDYVADGFAVSLFRKCSTHNS
LPGESLGTCYNNNGIIVEEDFWQNSEDPTAHHFSIDYNHVHNIVSWVDLGSFIDGNRTMV
IKIKPSSRVRVDAALYYNDNWYNISAELDKPNGDAITFSAATGGEISKVYLKKIAILRND
DVSVSTSIIKQPDNVNFDYQMNTTLYTFSSKWDRFTVTFNEYSSLYRLVNDDSLNIAPGC
VMHLYGCNDPSSIKVGKTIFKVKNGDYIRIPWGTEPSDEPNSIYDYYIDGNNFFDLVSIY
DLSCPSSPKCWNNPASYCEKRRDNIYPTYWNSYVTYVNIRSNGNCGTAINNKTTYWVCGE
IIKFPFGLGDYEEIDLSYRAKEYRWNSNFVWYFPGKEVAGFVAWNNHNIRVGDIDSGVPH
SNIRYIQYYIKYKNNILSVSTSHGLPTFSKYYTGNLDRLYLRTGTHMCSSESGRNWWYIF
FVAKRKIGDIKSEKQAPLVYKVKVGGTIEGDKDYVKKMIEKYKNYVKNIKVYVDI
Download sequence
Identical sequences Q74M73
228908.NEQ442 gi|41615226|ref|NP_963724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]