SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 229193.YP_0593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  229193.YP_0593
Domain Number 1 Region: 33-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-49
Family Ribonuclease PH domain 1-like 0.0000155
Further Details:      
 
Domain Number 2 Region: 325-520
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-47
Family Ribonuclease PH domain 1-like 0.0000161
Further Details:      
 
Domain Number 3 Region: 177-267
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-30
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 4 Region: 482-580
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.01e-28
Family Ribonuclease PH domain 2-like 0.0000798
Further Details:      
 
Domain Number 5 Region: 586-671
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 6 Region: 652-727
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-21
Family Cold shock DNA-binding domain-like 0.0000297
Further Details:      
 
Domain Number 7 Region: 270-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.45e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 229193.YP_0593
Sequence length 737
Comment (Yersinia pestis biovar Microtus 91001)
Sequence
MSLVARMQCEGISNRWIRSSIRSGTAKHKGTILLTPIIRKFQYGQHTVTIETGMMARQAT
AAVMVSMDDTAVFVTVVGQKKAKPGQSFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGE
TLTSRLIDRPIRPLFPDSFLNEVQVIATVVSVNPQINPDIVALIGASAALSLSGIPFNGP
IGAARVGFINDQYVLNPTTDELKESRLDLVVAGTAGAVLMVESEADILSEEQMLGAVVFG
HEQQQVVIENINALVAEAGKPKWDWQAEPVNEALHARVAELAEARLGDAYRITEKQERYT
QVDAIKADVTEALLAQDDTLDAAEIQDILASVEKNVVRSRVLRGEPRIDGREKDMIRGLD
VRTGILPRTHGSALFTRGETQALVTATLGTARDAQNIDELMGERTDSFLLHYNFPPYCVG
ETGMVGSPKRREIGHGRLAKRGVLAVMPSASEFPYTIRVVSEITESNGSSSMASVCGASL
ALMDAGVPIKAAVAGIAMGLVKEGDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMD
IKIEGITREIMQVALNQAKGARLHILGVMEQAISTPRGDISEFAPRIYTMKINPEKIKDV
IGKGGSVIRALTDETGTTIEIEDDGTIKIAATDGDKAKHAIRRIEEITAEIEVGRIYAGK
VTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLS
IKEATTPDAEAPEAAAE
Download sequence
Identical sequences gi|22124608|ref|NP_668031.1| gi|45440447|ref|NP_991986.1| 187410.y0694 229193.YP_0593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]