SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 229193.YP_3458 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  229193.YP_3458
Domain Number - Region: 7-43
Classification Level Classification E-value
Superfamily YfgJ-like 0.00327
Family YfgJ-like 0.0075
Further Details:      
 
Domain Number - Region: 51-86
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00896
Family Paired domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 229193.YP_3458
Sequence length 89
Comment (Yersinia pestis biovar Microtus 91001)
Sequence
MLMACINVHCPRCDSALVYRHGQNPKGQSRFRCRECRSVFQLTYTYQARKPEVKGQIVDI
AFSGTGVWDTARTLKIGINTVIRTLKNSC
Download sequence
Identical sequences A0A0H2W968
229193.YP_3458 gi|45443201|ref|NP_994740.1| gi|384137022|ref|YP_005519724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]