SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 232721.Ajs_0953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  232721.Ajs_0953
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-49
Family Ribonuclease PH domain 1-like 0.0000174
Further Details:      
 
Domain Number 2 Region: 298-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-47
Family Ribonuclease PH domain 1-like 0.0000148
Further Details:      
 
Domain Number 3 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.27e-29
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 147-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-28
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 5 Region: 557-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.21e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 622-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.7e-20
Family Cold shock DNA-binding domain-like 0.0002
Further Details:      
 
Domain Number 7 Region: 241-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.11e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 232721.Ajs_0953
Sequence length 727
Comment (Acidovorax JS42)
Sequence
MSIFNKVTKSFQWGDKTVVMETGEIARQASGAVLVNIDDTVVLATVVGSKQAKPGQDFFP
LTVDYIEKTYAAGKIPGSFFKREAKPSELETLTSRLIDRPIRPLFPEGFYNEVHVVIHTI
SLNPEVDADIAAMIAVSAALSVSGIPFNGPIGAARVGYVNGEYVLNPGQTARKSSQLDLV
VAGTEAAVLMVESEAQQLSEEIMLGAVVFGHEQGKVAINAIHELVRDAGKPVWDWQPPAK
DETFIAKVTALAEGKLRAAYQIRSKQARTQALREASASVLESLKGEGVEFDAVKVEALLF
DIEAKIVRSQILAGEPRIDGRDTRTVRPIEIRNSVLPRTHGSALFTRGETQALVVSTLGT
ERDAQRIDALAGEFEDRFIFHYNMPPFATGEVGRMGSTKRREIGHGRLAKRALVACLPSK
DEFPYTIRVVSEITESNGSSSMASVCGGCLSLMDAGVPMKAHVAGIAMGLIKEDNRFAVL
TDILGDEDHLGDMDFKVAGTTNGITALQMDIKIQGITKEIMQVALAQAKEARMHILGKMQ
EAMGEAKTEISSFAPKLYTMKINPEKIRDVIGKGGATIRALTDETGCQINIEEDGTITIA
ATEAAKADEAKRRIEEITAEVEVGKIYEGPVTKILDFGALINLLPGKDGLLHISQIAHER
VEKVGDYLQEGQIVKVKVLETDDKGRVKLSMKALADRPAGDSGRPAPAERGERRERRDGG
ASEQQQQ
Download sequence
Identical sequences A1W4L8
WP_011804394.1.39107 232721.Ajs_0953 gi|121593373|ref|YP_985269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]