SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 233150.MGA_0141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  233150.MGA_0141
Domain Number 1 Region: 345-477
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.53e-21
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 226-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000102
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 233150.MGA_0141
Sequence length 596
Comment (Mycoplasma gallisepticum)
Sequence
MRYMITISILLMYLIVGLLTALTVLIFVFILLKFYEFRFFKQTETYQRELEQEILKINNQ
EELEEKLKEHYLFQSNHKVFTKRDLREIRNFFIAVLSDKILLENKNKLLSNEIIEKKKEN
EELKTKLDAKKVEEKITLLKEMNLTHEEAKKRLLEEYRGYVRNDLDKMVKEEEKAANDKK
NAITNELNKLLINAMGNVSLLTETVRMNTVKTIKYEYVDVDPIKVKKVTDDFFGKIIGKE
ARNKKYIERLFNVEIIIKPESSRISISSFNTIKLEVAYNALNKIIEAVNDQGTHVLDESL
IRKSWYGALNEFSAEAKRIGEETLKELGLYESAFIPTKEISEFIGRLKFRGSNTQNVLTH
SIEAAQIAESIADQLNLNKEKAKVCALLHDIGKAIDKESVSSEGKWKNLKYAANDHVSAG
VEIAQYYKFDIDIIDAINCHHGRKKIYEKSKNFYAKITKIADFLSAARPGVRFVKDNDIE
RRFDTISNILTKYVDEKIISTYKILKNGYNINLMINPDITESEYSQLTLDLKKDIESDKE
LSKYPITITYVQNITRSETTNAIAHAKKTVEIYSEDKAELVNDEELSTVEFLDEDI
Download sequence
Identical sequences 233150.MGA_0141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]