SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 233412.HD1470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  233412.HD1470
Domain Number 1 Region: 295-461
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-33
Family Histidine kinase 0.003
Further Details:      
 
Domain Number 2 Region: 228-304
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000824
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 189-240
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000745
Family HAMP domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 233412.HD1470
Sequence length 464
Comment (Haemophilus ducreyi 35000HP)
Sequence
MPKFLKKIKSVRNYLAYQLFAYFGLTFAIMLAITLAIPNFDARSFSRLEKGEHEFFIQES
RQTELQYNLDEIFERRLSVATQNGFNIILFDPKTRIFVGAGADSNRIQSFQVFLYRAQTP
LEPLQRRFGSLEISGPFLVKSNKREYMQYFAQIVDPQEEFFNRIFDSPWLMLMIVLIVSV
PILLWLSWKIARPVKELRICANAVATGNLAINPKLETEGIHEFREVGRSFNQMITSLQEL
TEYQQRLLSDISHELKTPLARLQLATALIRRRNGDSAELTRIDNQIMKLDTMVHDLLSLS
RQQINQHLMREVFSINKIWDDILEDAKFEAEQNQIDLFIEQRIDNVEGYFINGNEIILAS
ALENLIRNAQKYAKQSITVLIYIDDKELVMSVDDDGEGVPESEYKQIFRPFYRVGEARDR
QSGGTGLGLAIVANAAQQHKGRVEAMKSILGGLRVETRLPLWLE
Download sequence
Identical sequences Q7VLH5
WP_010945317.1.19715 WP_010945317.1.2534 WP_010945317.1.34146 WP_010945317.1.41579 WP_010945317.1.69448 WP_010945317.1.70555 WP_010945317.1.77494 WP_010945317.1.78970 WP_010945317.1.84729 WP_010945317.1.91697 WP_010945317.1.99406 GO.3331 gi|33152530|ref|NP_873883.1| 233412.HD1470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]