SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 233413.Mb0323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  233413.Mb0323
Domain Number 1 Region: 45-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-44
Family Glycosyl hydrolases family 16 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 233413.Mb0323
Sequence length 294
Comment (Mycobacterium bovis)
Sequence
MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPAPAAPAAATGGLLFHD
EFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQNVFLDGNSNLVLRATR
EGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSNDDPGRSGEIDLIEWYGN
GTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMYFWLDYADGIEPYFSVPAT
GIEDLNEPIREWPFNDPGYTVFPVLNLAVGGSGGGDPATGSYPQEMLVDWVRVF
Download sequence
Identical sequences A0A0H3M7R0 A0A197IUQ7 A0A1A9T765 A0A1R3XUY5 A0A1S1B956 A0A2I7F2P6 F8M0Z1 M8CTE7 Q7DA14
gi|31791494|ref|NP_853987.1| gi|378770063|ref|YP_005169796.1| gi|224988703|ref|YP_002643390.1| gi|385997089|ref|YP_005915387.1| gi|339630389|ref|YP_004722031.1| gi|544161384|ref|YP_002160415.2| gi|479054253|ref|YP_007350059.1| 233413.Mb0323 336982.TBFG_10320 410289.BCG_0355 561275.JTY_0325 83331.MT0329 gi|121636230|ref|YP_976453.1| gi|15839702|ref|NP_334739.1| gi|433629412|ref|YP_007263040.1| gi|383306244|ref|YP_005359055.1| gi|375294523|ref|YP_005098790.1| WP_003401621.1.100000 WP_003401621.1.100021 WP_003401621.1.100069 WP_003401621.1.100087 WP_003401621.1.10015 WP_003401621.1.10022 WP_003401621.1.100260 WP_003401621.1.100270 WP_003401621.1.100279 WP_003401621.1.100286 WP_003401621.1.100309 WP_003401621.1.100318 WP_003401621.1.100337 WP_003401621.1.100338 WP_003401621.1.100383 WP_003401621.1.100395 WP_003401621.1.100396 WP_003401621.1.1004 WP_003401621.1.100552 WP_003401621.1.100581 WP_003401621.1.100600 WP_003401621.1.100625 WP_003401621.1.10064 WP_003401621.1.100666 WP_003401621.1.100671 WP_003401621.1.100677 WP_003401621.1.100682 WP_003401621.1.100757 WP_003401621.1.100772 WP_003401621.1.100812 WP_003401621.1.100845 WP_003401621.1.10088 WP_003401621.1.10090 WP_003401621.1.100910 WP_003401621.1.100918 WP_003401621.1.100935 WP_003401621.1.100992 WP_003401621.1.101 WP_003401621.1.101025 WP_003401621.1.101028 WP_003401621.1.10104 WP_003401621.1.101048 WP_003401621.1.101054 WP_003401621.1.101075 WP_003401621.1.101146 WP_003401621.1.10116 WP_003401621.1.10117 WP_003401621.1.101290 WP_003401621.1.101323 WP_003401621.1.101367 WP_003401621.1.101398 WP_003401621.1.101403 WP_003401621.1.101421 WP_003401621.1.10145 WP_003401621.1.101452 WP_003401621.1.101456 WP_003401621.1.101481 WP_003401621.1.101493 WP_003401621.1.101496 WP_003401621.1.101525 WP_003401621.1.101533 WP_003401621.1.101535 WP_003401621.1.101558 WP_003401621.1.10156 WP_003401621.1.101604 WP_003401621.1.101622 WP_003401621.1.101644 WP_003401621.1.101671 WP_003401621.1.10170 WP_003401621.1.101713 WP_003401621.1.101722 WP_003401621.1.101733 WP_003401621.1.101753 WP_003401621.1.101795 WP_003401621.1.101798 WP_003401621.1.101826 WP_003401621.1.101836 WP_003401621.1.101858 WP_003401621.1.101859 WP_003401621.1.101862 WP_003401621.1.101888 WP_003401621.1.101894 WP_003401621.1.1019 WP_003401621.1.101923 WP_003401621.1.101925 WP_003401621.1.10193 WP_003401621.1.101996 WP_003401621.1.102008 WP_003401621.1.102055 WP_003401621.1.102099 WP_003401621.1.1021 WP_003401621.1.10211 WP_003401621.1.102143 WP_003401621.1.10216 WP_003401621.1.10224 WP_003401621.1.10253 WP_003401621.1.10272 WP_003401621.1.10277 WP_003401621.1.1033 WP_003401621.1.10362 WP_003401621.1.10366 WP_003401621.1.10376 WP_003401621.1.10410 WP_003401621.1.10414 WP_003401621.1.10421 WP_003401621.1.1044 WP_003401621.1.10440 WP_003401621.1.10445 WP_003401621.1.10471 WP_003401621.1.10472 WP_003401621.1.10489 WP_003401621.1.10518 WP_003401621.1.10594 WP_003401621.1.10603 WP_003401621.1.10606 WP_003401621.1.10615 WP_003401621.1.10623 WP_003401621.1.10635 WP_003401621.1.10648 WP_003401621.1.10662 WP_003401621.1.10735 WP_003401621.1.1078 WP_003401621.1.10791 WP_003401621.1.10799 WP_003401621.1.10863 WP_003401621.1.10912 WP_003401621.1.10916 WP_003401621.1.10923 WP_003401621.1.10927 WP_003401621.1.10958 WP_003401621.1.10962 WP_003401621.1.10981 WP_003401621.1.10993 WP_003401621.1.11040 WP_003401621.1.11061 WP_003401621.1.11070 WP_003401621.1.11141 WP_003401621.1.11176 WP_003401621.1.11236 WP_003401621.1.11329 WP_003401621.1.1133 WP_003401621.1.11342 WP_003401621.1.11376 WP_003401621.1.11402 WP_003401621.1.11481 WP_003401621.1.11487 WP_003401621.1.11491 WP_003401621.1.11514 WP_003401621.1.11587 WP_003401621.1.11589 WP_003401621.1.11604 WP_003401621.1.11610 WP_003401621.1.11707 WP_003401621.1.11752 WP_003401621.1.11758 WP_003401621.1.11775 WP_003401621.1.11804 WP_003401621.1.11822 WP_003401621.1.11826 WP_003401621.1.11906 WP_003401621.1.11939 WP_003401621.1.11972 WP_003401621.1.11984 WP_003401621.1.120 WP_003401621.1.12001 WP_003401621.1.12100 WP_003401621.1.12130 WP_003401621.1.12133 WP_003401621.1.12161 WP_003401621.1.12165 WP_003401621.1.12184 WP_003401621.1.12187 WP_003401621.1.12216 WP_003401621.1.12265 WP_003401621.1.12275 WP_003401621.1.12293 WP_003401621.1.123 WP_003401621.1.12314 WP_003401621.1.12327 WP_003401621.1.12338 WP_003401621.1.12371 WP_003401621.1.12372 WP_003401621.1.12389 WP_003401621.1.12406 WP_003401621.1.1241 WP_003401621.1.12421 WP_003401621.1.12424 WP_003401621.1.12446 WP_003401621.1.12464 WP_003401621.1.12479 WP_003401621.1.12519 WP_003401621.1.12523 WP_003401621.1.12550 WP_003401621.1.12551 WP_003401621.1.12563 WP_003401621.1.12611 WP_003401621.1.12669 WP_003401621.1.1267 WP_003401621.1.12710 WP_003401621.1.12768 WP_003401621.1.12794 WP_003401621.1.12801 WP_003401621.1.12821 WP_003401621.1.12841 WP_003401621.1.12854 WP_003401621.1.12871 WP_003401621.1.12901 WP_003401621.1.12941 WP_003401621.1.12972 WP_003401621.1.13028 WP_003401621.1.13086 WP_003401621.1.13087 WP_003401621.1.13163 WP_003401621.1.13183 WP_003401621.1.13249 WP_003401621.1.13282 WP_003401621.1.13296 WP_003401621.1.13298 WP_003401621.1.13302 WP_003401621.1.13312 WP_003401621.1.13313 WP_003401621.1.13321 WP_003401621.1.13345 WP_003401621.1.13358 WP_003401621.1.13370 WP_003401621.1.1338 WP_003401621.1.13420 WP_003401621.1.13433 WP_003401621.1.13435 WP_003401621.1.13438 WP_003401621.1.13466 WP_003401621.1.13489 WP_003401621.1.13526 WP_003401621.1.13551 WP_003401621.1.13561 WP_003401621.1.13579 WP_003401621.1.13719 WP_003401621.1.13763 WP_003401621.1.1377 WP_003401621.1.13774 WP_003401621.1.13786 WP_003401621.1.13793 WP_003401621.1.13794 WP_003401621.1.13817 WP_003401621.1.13880 WP_003401621.1.13899 WP_003401621.1.13909 WP_003401621.1.13910 WP_003401621.1.13952 WP_003401621.1.13953 WP_003401621.1.13962 WP_003401621.1.1398 WP_003401621.1.14027 WP_003401621.1.14115 WP_003401621.1.14152 WP_003401621.1.14162 WP_003401621.1.14175 WP_003401621.1.14194 WP_003401621.1.14195 WP_003401621.1.14238 WP_003401621.1.14273 WP_003401621.1.14306 WP_003401621.1.14307 WP_003401621.1.14310 WP_003401621.1.14341 WP_003401621.1.14382 WP_003401621.1.14428 WP_003401621.1.14441 WP_003401621.1.14469 WP_003401621.1.14504 WP_003401621.1.1452 WP_003401621.1.14527 WP_003401621.1.14544 WP_003401621.1.14551 WP_003401621.1.14561 WP_003401621.1.14573 WP_003401621.1.1462 WP_003401621.1.14658 WP_003401621.1.14668 WP_003401621.1.14675 WP_003401621.1.14694 WP_003401621.1.14695 WP_003401621.1.14709 WP_003401621.1.14766 WP_003401621.1.14783 WP_003401621.1.14865 WP_003401621.1.14872 WP_003401621.1.14905 WP_003401621.1.14926 WP_003401621.1.14955 WP_003401621.1.15009 WP_003401621.1.15040 WP_003401621.1.15065 WP_003401621.1.15089 WP_003401621.1.1509 WP_003401621.1.15126 WP_003401621.1.15131 WP_003401621.1.15172 WP_003401621.1.15174 WP_003401621.1.15187 WP_003401621.1.15196 WP_003401621.1.15217 WP_003401621.1.1523 WP_003401621.1.15240 WP_003401621.1.15253 WP_003401621.1.15267 WP_003401621.1.1527 WP_003401621.1.15292 WP_003401621.1.15302 WP_003401621.1.15322 WP_003401621.1.15345 WP_003401621.1.15372 WP_003401621.1.15386 WP_003401621.1.15442 WP_003401621.1.15447 WP_003401621.1.15449 WP_003401621.1.15477 WP_003401621.1.15511 WP_003401621.1.15558 WP_003401621.1.15559 WP_003401621.1.15566 WP_003401621.1.15599 WP_003401621.1.1560 WP_003401621.1.1563 WP_003401621.1.15633 WP_003401621.1.15643 WP_003401621.1.15755 WP_003401621.1.15763 WP_003401621.1.15774 WP_003401621.1.1578 WP_003401621.1.15780 WP_003401621.1.15827 WP_003401621.1.15877 WP_003401621.1.15893 WP_003401621.1.15896 WP_003401621.1.15926 WP_003401621.1.15958 WP_003401621.1.15973 WP_003401621.1.16043 WP_003401621.1.16055 WP_003401621.1.16066 WP_003401621.1.16077 WP_003401621.1.16110 WP_003401621.1.16136 WP_003401621.1.16139 WP_003401621.1.16143 WP_003401621.1.1630 WP_003401621.1.16318 WP_003401621.1.1632 WP_003401621.1.16327 WP_003401621.1.16334 WP_003401621.1.16374 WP_003401621.1.16384 WP_003401621.1.16386 WP_003401621.1.1642 WP_003401621.1.16421 WP_003401621.1.16424 WP_003401621.1.16426 WP_003401621.1.16431 WP_003401621.1.16438 WP_003401621.1.1644 WP_003401621.1.16442 WP_003401621.1.16448 WP_003401621.1.16451 WP_003401621.1.16476 WP_003401621.1.1652 WP_003401621.1.16609 WP_003401621.1.16620 WP_003401621.1.16622 WP_003401621.1.1669 WP_003401621.1.16707 WP_003401621.1.16724 WP_003401621.1.16731 WP_003401621.1.1683 WP_003401621.1.16837 WP_003401621.1.16937 WP_003401621.1.16940 WP_003401621.1.16959 WP_003401621.1.16968 WP_003401621.1.1697 WP_003401621.1.16973 WP_003401621.1.16977 WP_003401621.1.17006 WP_003401621.1.17010 WP_003401621.1.17039 WP_003401621.1.17041 WP_003401621.1.17057 WP_003401621.1.17062 WP_003401621.1.1707 WP_003401621.1.17138 WP_003401621.1.17167 WP_003401621.1.17224 WP_003401621.1.17251 WP_003401621.1.17304 WP_003401621.1.17314 WP_003401621.1.17345 WP_003401621.1.17381 WP_003401621.1.17391 WP_003401621.1.17412 WP_003401621.1.1743 WP_003401621.1.17477 WP_003401621.1.17483 WP_003401621.1.17505 WP_003401621.1.17527 WP_003401621.1.17535 WP_003401621.1.17553 WP_003401621.1.17679 WP_003401621.1.1768 WP_003401621.1.17687 WP_003401621.1.17713 WP_003401621.1.17722 WP_003401621.1.17746 WP_003401621.1.17788 WP_003401621.1.17803 WP_003401621.1.17816 WP_003401621.1.17821 WP_003401621.1.17868 WP_003401621.1.17923 WP_003401621.1.1795 WP_003401621.1.17955 WP_003401621.1.17973 WP_003401621.1.18009 WP_003401621.1.18013 WP_003401621.1.18033 WP_003401621.1.18057 WP_003401621.1.18065 WP_003401621.1.18070 WP_003401621.1.18120 WP_003401621.1.18126 WP_003401621.1.1817 WP_003401621.1.18240 WP_003401621.1.18297 WP_003401621.1.18306 WP_003401621.1.18364 WP_003401621.1.18399 WP_003401621.1.18411 WP_003401621.1.18444 WP_003401621.1.18448 WP_003401621.1.18582 WP_003401621.1.18587 WP_003401621.1.186 WP_003401621.1.18639 WP_003401621.1.1868 WP_003401621.1.18694 WP_003401621.1.18710 WP_003401621.1.18751 WP_003401621.1.18793 WP_003401621.1.18827 WP_003401621.1.18838 WP_003401621.1.18945 WP_003401621.1.1898 WP_003401621.1.19005 WP_003401621.1.19063 WP_003401621.1.19066 WP_003401621.1.19071 WP_003401621.1.19085 WP_003401621.1.19094 WP_003401621.1.19144 WP_003401621.1.19159 WP_003401621.1.19193 WP_003401621.1.19231 WP_003401621.1.19264 WP_003401621.1.19307 WP_003401621.1.19326 WP_003401621.1.1933 WP_003401621.1.19364 WP_003401621.1.19382 WP_003401621.1.19426 WP_003401621.1.19429 WP_003401621.1.19512 WP_003401621.1.19562 WP_003401621.1.19564 WP_003401621.1.19568 WP_003401621.1.19600 WP_003401621.1.19630 WP_003401621.1.1967 WP_003401621.1.19694 WP_003401621.1.19742 WP_003401621.1.19820 WP_003401621.1.19868 WP_003401621.1.19874 WP_003401621.1.19890 WP_003401621.1.19900 WP_003401621.1.19946 WP_003401621.1.19949 WP_003401621.1.19960 WP_003401621.1.20007 WP_003401621.1.20016 WP_003401621.1.20028 WP_003401621.1.2003 WP_003401621.1.20039 WP_003401621.1.20082 WP_003401621.1.20116 WP_003401621.1.20140 WP_003401621.1.20141 WP_003401621.1.20158 WP_003401621.1.20239 WP_003401621.1.20243 WP_003401621.1.20259 WP_003401621.1.20262 WP_003401621.1.20268 WP_003401621.1.20272 WP_003401621.1.20273 WP_003401621.1.20280 WP_003401621.1.20294 WP_003401621.1.20322 WP_003401621.1.2037 WP_003401621.1.20372 WP_003401621.1.20381 WP_003401621.1.204 WP_003401621.1.20427 WP_003401621.1.20457 WP_003401621.1.20460 WP_003401621.1.20542 WP_003401621.1.20608 WP_003401621.1.20624 WP_003401621.1.20628 WP_003401621.1.2066 WP_003401621.1.20722 WP_003401621.1.2086 WP_003401621.1.20868 WP_003401621.1.20897 WP_003401621.1.20898 WP_003401621.1.2090 WP_003401621.1.20911 WP_003401621.1.20916 WP_003401621.1.20921 WP_003401621.1.20926 WP_003401621.1.20927 WP_003401621.1.20970 WP_003401621.1.2104 WP_003401621.1.21070 WP_003401621.1.21135 WP_003401621.1.21173 WP_003401621.1.21187 WP_003401621.1.2120 WP_003401621.1.21218 WP_003401621.1.2123 WP_003401621.1.21234 WP_003401621.1.2126 WP_003401621.1.21292 WP_003401621.1.21307 WP_003401621.1.21321 WP_003401621.1.21365 WP_003401621.1.2137 WP_003401621.1.21397 WP_003401621.1.21415 WP_003401621.1.21430 WP_003401621.1.21434 WP_003401621.1.21444 WP_003401621.1.21509 WP_003401621.1.21560 WP_003401621.1.21591 WP_003401621.1.21594 WP_003401621.1.21615 WP_003401621.1.21655 WP_003401621.1.21658 WP_003401621.1.2168 WP_003401621.1.2174 WP_003401621.1.21741 WP_003401621.1.21786 WP_003401621.1.21795 WP_003401621.1.218 WP_003401621.1.21829 WP_003401621.1.21840 WP_003401621.1.21843 WP_003401621.1.21872 WP_003401621.1.21873 WP_003401621.1.2188 WP_003401621.1.21882 WP_003401621.1.21941 WP_003401621.1.21960 WP_003401621.1.21971 WP_003401621.1.22025 WP_003401621.1.22036 WP_003401621.1.22092 WP_003401621.1.22127 WP_003401621.1.22140 WP_003401621.1.22255 WP_003401621.1.22305 WP_003401621.1.22348 WP_003401621.1.22356 WP_003401621.1.2238 WP_003401621.1.22437 WP_003401621.1.22445 WP_003401621.1.22511 WP_003401621.1.22524 WP_003401621.1.2253 WP_003401621.1.22585 WP_003401621.1.22589 WP_003401621.1.22606 WP_003401621.1.22608 WP_003401621.1.2262 WP_003401621.1.22629 WP_003401621.1.22647 WP_003401621.1.22664 WP_003401621.1.22674 WP_003401621.1.22680 WP_003401621.1.22725 WP_003401621.1.22728 WP_003401621.1.22733 WP_003401621.1.22737 WP_003401621.1.2275 WP_003401621.1.22797 WP_003401621.1.22800 WP_003401621.1.22829 WP_003401621.1.22840 WP_003401621.1.22844 WP_003401621.1.22963 WP_003401621.1.22997 WP_003401621.1.22999 WP_003401621.1.23015 WP_003401621.1.231 WP_003401621.1.23101 WP_003401621.1.23140 WP_003401621.1.23153 WP_003401621.1.23171 WP_003401621.1.23199 WP_003401621.1.2320 WP_003401621.1.23216 WP_003401621.1.23233 WP_003401621.1.23261 WP_003401621.1.23272 WP_003401621.1.23289 WP_003401621.1.2329 WP_003401621.1.23308 WP_003401621.1.23316 WP_003401621.1.23321 WP_003401621.1.23325 WP_003401621.1.2339 WP_003401621.1.23406 WP_003401621.1.23438 WP_003401621.1.23445 WP_003401621.1.23447 WP_003401621.1.23452 WP_003401621.1.23461 WP_003401621.1.23497 WP_003401621.1.23506 WP_003401621.1.23530 WP_003401621.1.23539 WP_003401621.1.23546 WP_003401621.1.23573 WP_003401621.1.23588 WP_003401621.1.23628 WP_003401621.1.23683 WP_003401621.1.23692 WP_003401621.1.23699 WP_003401621.1.23803 WP_003401621.1.23832 WP_003401621.1.2384 WP_003401621.1.23863 WP_003401621.1.2387 WP_003401621.1.23894 WP_003401621.1.23993 WP_003401621.1.24007 WP_003401621.1.24008 WP_003401621.1.24046 WP_003401621.1.24057 WP_003401621.1.24062 WP_003401621.1.24113 WP_003401621.1.24119 WP_003401621.1.24128 WP_003401621.1.24202 WP_003401621.1.24261 WP_003401621.1.24284 WP_003401621.1.24396 WP_003401621.1.24414 WP_003401621.1.24423 WP_003401621.1.2443 WP_003401621.1.24446 WP_003401621.1.24500 WP_003401621.1.24507 WP_003401621.1.24509 WP_003401621.1.24553 WP_003401621.1.24599 WP_003401621.1.24629 WP_003401621.1.24638 WP_003401621.1.24648 WP_003401621.1.2466 WP_003401621.1.24824 WP_003401621.1.24831 WP_003401621.1.24840 WP_003401621.1.24848 WP_003401621.1.24857 WP_003401621.1.2487 WP_003401621.1.24893 WP_003401621.1.24958 WP_003401621.1.24985 WP_003401621.1.2499 WP_003401621.1.25004 WP_003401621.1.2505 WP_003401621.1.2507 WP_003401621.1.25096 WP_003401621.1.25103 WP_003401621.1.25129 WP_003401621.1.25171 WP_003401621.1.25247 WP_003401621.1.25252 WP_003401621.1.25278 WP_003401621.1.25283 WP_003401621.1.25313 WP_003401621.1.25338 WP_003401621.1.25342 WP_003401621.1.25343 WP_003401621.1.25406 WP_003401621.1.25435 WP_003401621.1.25437 WP_003401621.1.25445 WP_003401621.1.25473 WP_003401621.1.25504 WP_003401621.1.25513 WP_003401621.1.25542 WP_003401621.1.25579 WP_003401621.1.25594 WP_003401621.1.25606 WP_003401621.1.25645 WP_003401621.1.25674 WP_003401621.1.25693 WP_003401621.1.25699 WP_003401621.1.25727 WP_003401621.1.25736 WP_003401621.1.25756 WP_003401621.1.25759 WP_003401621.1.2580 WP_003401621.1.25813 WP_003401621.1.25853 WP_003401621.1.25854 WP_003401621.1.25874 WP_003401621.1.25885 WP_003401621.1.25892 WP_003401621.1.25906 WP_003401621.1.25914 WP_003401621.1.25954 WP_003401621.1.25965 WP_003401621.1.25972 WP_003401621.1.26017 WP_003401621.1.26032 WP_003401621.1.26072 WP_003401621.1.26089 WP_003401621.1.26097 WP_003401621.1.26108 WP_003401621.1.26126 WP_003401621.1.2614 WP_003401621.1.26168 WP_003401621.1.26182 WP_003401621.1.26190 WP_003401621.1.2620 WP_003401621.1.26234 WP_003401621.1.26243 WP_003401621.1.26265 WP_003401621.1.26267 WP_003401621.1.26310 WP_003401621.1.26349 WP_003401621.1.26366 WP_003401621.1.26374 WP_003401621.1.26407 WP_003401621.1.26412 WP_003401621.1.26454 WP_003401621.1.26464 WP_003401621.1.2653 WP_003401621.1.2659 WP_003401621.1.26603 WP_003401621.1.26629 WP_003401621.1.26707 WP_003401621.1.26710 WP_003401621.1.26738 WP_003401621.1.26745 WP_003401621.1.26756 WP_003401621.1.2676 WP_003401621.1.26780 WP_003401621.1.26798 WP_003401621.1.26854 WP_003401621.1.26876 WP_003401621.1.26888 WP_003401621.1.26959 WP_003401621.1.26969 WP_003401621.1.26984 WP_003401621.1.27004 WP_003401621.1.27017 WP_003401621.1.27045 WP_003401621.1.27075 WP_003401621.1.27128 WP_003401621.1.27130 WP_003401621.1.27139 WP_003401621.1.27152 WP_003401621.1.27162 WP_003401621.1.27164 WP_003401621.1.27193 WP_003401621.1.27235 WP_003401621.1.27254 WP_003401621.1.27278 WP_003401621.1.27352 WP_003401621.1.27369 WP_003401621.1.27391 WP_003401621.1.27398 WP_003401621.1.27402 WP_003401621.1.27410 WP_003401621.1.27411 WP_003401621.1.27449 WP_003401621.1.27463 WP_003401621.1.2749 WP_003401621.1.27492 WP_003401621.1.27528 WP_003401621.1.27541 WP_003401621.1.27582 WP_003401621.1.27596 WP_003401621.1.27607 WP_003401621.1.2766 WP_003401621.1.27724 WP_003401621.1.27730 WP_003401621.1.27736 WP_003401621.1.27743 WP_003401621.1.27779 WP_003401621.1.27803 WP_003401621.1.27819 WP_003401621.1.27835 WP_003401621.1.27915 WP_003401621.1.27935 WP_003401621.1.27962 WP_003401621.1.28053 WP_003401621.1.28106 WP_003401621.1.28142 WP_003401621.1.2816 WP_003401621.1.28161 WP_003401621.1.28192 WP_003401621.1.28241 WP_003401621.1.28251 WP_003401621.1.28255 WP_003401621.1.28269 WP_003401621.1.28276 WP_003401621.1.28293 WP_003401621.1.28331 WP_003401621.1.28378 WP_003401621.1.2842 WP_003401621.1.28448 WP_003401621.1.2847 WP_003401621.1.28471 WP_003401621.1.28473 WP_003401621.1.28561 WP_003401621.1.28610 WP_003401621.1.28634 WP_003401621.1.28642 WP_003401621.1.28671 WP_003401621.1.28682 WP_003401621.1.28703 WP_003401621.1.28739 WP_003401621.1.28758 WP_003401621.1.28781 WP_003401621.1.28914 WP_003401621.1.28935 WP_003401621.1.28936 WP_003401621.1.28939 WP_003401621.1.28943 WP_003401621.1.28952 WP_003401621.1.28975 WP_003401621.1.2899 WP_003401621.1.28993 WP_003401621.1.29000 WP_003401621.1.2901 WP_003401621.1.29028 WP_003401621.1.29078 WP_003401621.1.29102 WP_003401621.1.29217 WP_003401621.1.29223 WP_003401621.1.29234 WP_003401621.1.29264 WP_003401621.1.29275 WP_003401621.1.29367 WP_003401621.1.29399 WP_003401621.1.29449 WP_003401621.1.29450 WP_003401621.1.29452 WP_003401621.1.29510 WP_003401621.1.29515 WP_003401621.1.29559 WP_003401621.1.29592 WP_003401621.1.29599 WP_003401621.1.29611 WP_003401621.1.29632 WP_003401621.1.29649 WP_003401621.1.2965 WP_003401621.1.29659 WP_003401621.1.2969 WP_003401621.1.29696 WP_003401621.1.29718 WP_003401621.1.29742 WP_003401621.1.29745 WP_003401621.1.29769 WP_003401621.1.29825 WP_003401621.1.29847 WP_003401621.1.29883 WP_003401621.1.29890 WP_003401621.1.299 WP_003401621.1.29960 WP_003401621.1.30014 WP_003401621.1.3004 WP_003401621.1.30040 WP_003401621.1.30043 WP_003401621.1.30074 WP_003401621.1.30097 WP_003401621.1.30101 WP_003401621.1.30106 WP_003401621.1.30114 WP_003401621.1.30126 WP_003401621.1.30131 WP_003401621.1.30138 WP_003401621.1.30139 WP_003401621.1.30145 WP_003401621.1.30224 WP_003401621.1.3027 WP_003401621.1.30279 WP_003401621.1.30282 WP_003401621.1.30288 WP_003401621.1.30291 WP_003401621.1.30363 WP_003401621.1.30374 WP_003401621.1.30404 WP_003401621.1.3043 WP_003401621.1.30433 WP_003401621.1.30462 WP_003401621.1.30464 WP_003401621.1.30468 WP_003401621.1.30500 WP_003401621.1.30574 WP_003401621.1.30628 WP_003401621.1.30641 WP_003401621.1.30642 WP_003401621.1.30661 WP_003401621.1.30669 WP_003401621.1.30683 WP_003401621.1.30699 WP_003401621.1.30730 WP_003401621.1.30732 WP_003401621.1.30736 WP_003401621.1.30745 WP_003401621.1.30760 WP_003401621.1.30791 WP_003401621.1.308 WP_003401621.1.30824 WP_003401621.1.30848 WP_003401621.1.30877 WP_003401621.1.30901 WP_003401621.1.30912 WP_003401621.1.30913 WP_003401621.1.30914 WP_003401621.1.30919 WP_003401621.1.3101 WP_003401621.1.31047 WP_003401621.1.31070 WP_003401621.1.31102 WP_003401621.1.31226 WP_003401621.1.31233 WP_003401621.1.31287 WP_003401621.1.31290 WP_003401621.1.31304 WP_003401621.1.31346 WP_003401621.1.31354 WP_003401621.1.31428 WP_003401621.1.31458 WP_003401621.1.3149 WP_003401621.1.31498 WP_003401621.1.31537 WP_003401621.1.31569 WP_003401621.1.316 WP_003401621.1.31629 WP_003401621.1.31744 WP_003401621.1.31745 WP_003401621.1.31776 WP_003401621.1.31783 WP_003401621.1.318 WP_003401621.1.3184 WP_003401621.1.31840 WP_003401621.1.31880 WP_003401621.1.31911 WP_003401621.1.31955 WP_003401621.1.31991 WP_003401621.1.32004 WP_003401621.1.32039 WP_003401621.1.3204 WP_003401621.1.32045 WP_003401621.1.32071 WP_003401621.1.32132 WP_003401621.1.32157 WP_003401621.1.32164 WP_003401621.1.32179 WP_003401621.1.32317 WP_003401621.1.32383 WP_003401621.1.32403 WP_003401621.1.32416 WP_003401621.1.32421 WP_003401621.1.32461 WP_003401621.1.32482 WP_003401621.1.32503 WP_003401621.1.32562 WP_003401621.1.32569 WP_003401621.1.32647 WP_003401621.1.32653 WP_003401621.1.32654 WP_003401621.1.3268 WP_003401621.1.32695 WP_003401621.1.32706 WP_003401621.1.32716 WP_003401621.1.32752 WP_003401621.1.32780 WP_003401621.1.32781 WP_003401621.1.32793 WP_003401621.1.32799 WP_003401621.1.32822 WP_003401621.1.32833 WP_003401621.1.32862 WP_003401621.1.32880 WP_003401621.1.32909 WP_003401621.1.32974 WP_003401621.1.33007 WP_003401621.1.3302 WP_003401621.1.33028 WP_003401621.1.33035 WP_003401621.1.33044 WP_003401621.1.33054 WP_003401621.1.33082 WP_003401621.1.33141 WP_003401621.1.33148 WP_003401621.1.33155 WP_003401621.1.33168 WP_003401621.1.3321 WP_003401621.1.33215 WP_003401621.1.3325 WP_003401621.1.33278 WP_003401621.1.33288 WP_003401621.1.33305 WP_003401621.1.3331 WP_003401621.1.3333 WP_003401621.1.33393 WP_003401621.1.33403 WP_003401621.1.33452 WP_003401621.1.33467 WP_003401621.1.3349 WP_003401621.1.33519 WP_003401621.1.33542 WP_003401621.1.33601 WP_003401621.1.33633 WP_003401621.1.33646 WP_003401621.1.33673 WP_003401621.1.33762 WP_003401621.1.33783 WP_003401621.1.33789 WP_003401621.1.3383 WP_003401621.1.33832 WP_003401621.1.33848 WP_003401621.1.3387 WP_003401621.1.33886 WP_003401621.1.33906 WP_003401621.1.33912 WP_003401621.1.33954 WP_003401621.1.3399 WP_003401621.1.34042 WP_003401621.1.3405 WP_003401621.1.34055 WP_003401621.1.34056 WP_003401621.1.34065 WP_003401621.1.34090 WP_003401621.1.34109 WP_003401621.1.34111 WP_003401621.1.34131 WP_003401621.1.34152 WP_003401621.1.34153 WP_003401621.1.34163 WP_003401621.1.34181 WP_003401621.1.34197 WP_003401621.1.34198 WP_003401621.1.34215 WP_003401621.1.34219 WP_003401621.1.34260 WP_003401621.1.34275 WP_003401621.1.343 WP_003401621.1.34358 WP_003401621.1.344 WP_003401621.1.34428 WP_003401621.1.3443 WP_003401621.1.34435 WP_003401621.1.34446 WP_003401621.1.34505 WP_003401621.1.34516 WP_003401621.1.34529 WP_003401621.1.34551 WP_003401621.1.34563 WP_003401621.1.34576 WP_003401621.1.34588 WP_003401621.1.34599 WP_003401621.1.34639 WP_003401621.1.34673 WP_003401621.1.34740 WP_003401621.1.34755 WP_003401621.1.34783 WP_003401621.1.34908 WP_003401621.1.3492 WP_003401621.1.34933 WP_003401621.1.34946 WP_003401621.1.34954 WP_003401621.1.34961 WP_003401621.1.34963 WP_003401621.1.34968 WP_003401621.1.35023 WP_003401621.1.35069 WP_003401621.1.35072 WP_003401621.1.35078 WP_003401621.1.35100 WP_003401621.1.35146 WP_003401621.1.35160 WP_003401621.1.35173 WP_003401621.1.3520 WP_003401621.1.35213 WP_003401621.1.35246 WP_003401621.1.35278 WP_003401621.1.35301 WP_003401621.1.35311 WP_003401621.1.35312 WP_003401621.1.35319 WP_003401621.1.35347 WP_003401621.1.35363 WP_003401621.1.35396 WP_003401621.1.35397 WP_003401621.1.35403 WP_003401621.1.35426 WP_003401621.1.35439 WP_003401621.1.35455 WP_003401621.1.35484 WP_003401621.1.35492 WP_003401621.1.3553 WP_003401621.1.35555 WP_003401621.1.35561 WP_003401621.1.35602 WP_003401621.1.35610 WP_003401621.1.35657 WP_003401621.1.35689 WP_003401621.1.35767 WP_003401621.1.35770 WP_003401621.1.35780 WP_003401621.1.35805 WP_003401621.1.35811 WP_003401621.1.3584 WP_003401621.1.35864 WP_003401621.1.35874 WP_003401621.1.35876 WP_003401621.1.35897 WP_003401621.1.35923 WP_003401621.1.3593 WP_003401621.1.36005 WP_003401621.1.36023 WP_003401621.1.36051 WP_003401621.1.36053 WP_003401621.1.36089 WP_003401621.1.36097 WP_003401621.1.36116 WP_003401621.1.36145 WP_003401621.1.36156 WP_003401621.1.36228 WP_003401621.1.36246 WP_003401621.1.36252 WP_003401621.1.36260 WP_003401621.1.36270 WP_003401621.1.36271 WP_003401621.1.36303 WP_003401621.1.36309 WP_003401621.1.36315 WP_003401621.1.36321 WP_003401621.1.36326 WP_003401621.1.3634 WP_003401621.1.36357 WP_003401621.1.3636 WP_003401621.1.36436 WP_003401621.1.36465 WP_003401621.1.36469 WP_003401621.1.36473 WP_003401621.1.36485 WP_003401621.1.36508 WP_003401621.1.36561 WP_003401621.1.36573 WP_003401621.1.36585 WP_003401621.1.36597 WP_003401621.1.36657 WP_003401621.1.36674 WP_003401621.1.36720 WP_003401621.1.36727 WP_003401621.1.36810 WP_003401621.1.36844 WP_003401621.1.36851 WP_003401621.1.36862 WP_003401621.1.36935 WP_003401621.1.36941 WP_003401621.1.3695 WP_003401621.1.36951 WP_003401621.1.37004 WP_003401621.1.37012 WP_003401621.1.37071 WP_003401621.1.37088 WP_003401621.1.37131 WP_003401621.1.37157 WP_003401621.1.37188 WP_003401621.1.37213 WP_003401621.1.3724 WP_003401621.1.37277 WP_003401621.1.37305 WP_003401621.1.37330 WP_003401621.1.37440 WP_003401621.1.37468 WP_003401621.1.37601 WP_003401621.1.37612 WP_003401621.1.37632 WP_003401621.1.37643 WP_003401621.1.37655 WP_003401621.1.37674 WP_003401621.1.37700 WP_003401621.1.37701 WP_003401621.1.37709 WP_003401621.1.37711 WP_003401621.1.37747 WP_003401621.1.37765 WP_003401621.1.37772 WP_003401621.1.37804 WP_003401621.1.37859 WP_003401621.1.37877 WP_003401621.1.37912 WP_003401621.1.37913 WP_003401621.1.37943 WP_003401621.1.37950 WP_003401621.1.38002 WP_003401621.1.3802 WP_003401621.1.38039 WP_003401621.1.38040 WP_003401621.1.38067 WP_003401621.1.38135 WP_003401621.1.38138 WP_003401621.1.38159 WP_003401621.1.38210 WP_003401621.1.38240 WP_003401621.1.38299 WP_003401621.1.38347 WP_003401621.1.38354 WP_003401621.1.38380 WP_003401621.1.38384 WP_003401621.1.38389 WP_003401621.1.38402 WP_003401621.1.38418 WP_003401621.1.38477 WP_003401621.1.38483 WP_003401621.1.3849 WP_003401621.1.38535 WP_003401621.1.38539 WP_003401621.1.38601 WP_003401621.1.38611 WP_003401621.1.38638 WP_003401621.1.38639 WP_003401621.1.38646 WP_003401621.1.38648 WP_003401621.1.38654 WP_003401621.1.38659 WP_003401621.1.38666 WP_003401621.1.38671 WP_003401621.1.38750 WP_003401621.1.38812 WP_003401621.1.38844 WP_003401621.1.38863 WP_003401621.1.38865 WP_003401621.1.38873 WP_003401621.1.38894 WP_003401621.1.38909 WP_003401621.1.38939 WP_003401621.1.38974 WP_003401621.1.38975 WP_003401621.1.39025 WP_003401621.1.39070 WP_003401621.1.39072 WP_003401621.1.39095 WP_003401621.1.39106 WP_003401621.1.39165 WP_003401621.1.39174 WP_003401621.1.39176 WP_003401621.1.39178 WP_003401621.1.39201 WP_003401621.1.39207 WP_003401621.1.39211 WP_003401621.1.39252 WP_003401621.1.39288 WP_003401621.1.39359 WP_003401621.1.39400 WP_003401621.1.39447 WP_003401621.1.3945 WP_003401621.1.39450 WP_003401621.1.39455 WP_003401621.1.3949 WP_003401621.1.39560 WP_003401621.1.39592 WP_003401621.1.39593 WP_003401621.1.396 WP_003401621.1.3960 WP_003401621.1.39654 WP_003401621.1.39657 WP_003401621.1.39661 WP_003401621.1.39674 WP_003401621.1.39678 WP_003401621.1.3968 WP_003401621.1.39694 WP_003401621.1.3971 WP_003401621.1.39718 WP_003401621.1.39728 WP_003401621.1.39748 WP_003401621.1.39751 WP_003401621.1.39801 WP_003401621.1.39804 WP_003401621.1.39925 WP_003401621.1.3996 WP_003401621.1.39980 WP_003401621.1.40000 WP_003401621.1.40028 WP_003401621.1.4003 WP_003401621.1.40094 WP_003401621.1.40156 WP_003401621.1.40174 WP_003401621.1.40276 WP_003401621.1.40353 WP_003401621.1.40372 WP_003401621.1.40446 WP_003401621.1.40451 WP_003401621.1.40455 WP_003401621.1.40523 WP_003401621.1.40543 WP_003401621.1.40641 WP_003401621.1.40651 WP_003401621.1.40653 WP_003401621.1.4067 WP_003401621.1.40705 WP_003401621.1.40731 WP_003401621.1.40735 WP_003401621.1.40795 WP_003401621.1.40799 WP_003401621.1.40852 WP_003401621.1.40881 WP_003401621.1.40948 WP_003401621.1.4095 WP_003401621.1.40956 WP_003401621.1.40957 WP_003401621.1.40964 WP_003401621.1.4097 WP_003401621.1.410 WP_003401621.1.41000 WP_003401621.1.41055 WP_003401621.1.41108 WP_003401621.1.41123 WP_003401621.1.41177 WP_003401621.1.41219 WP_003401621.1.41249 WP_003401621.1.4127 WP_003401621.1.41296 WP_003401621.1.41355 WP_003401621.1.41376 WP_003401621.1.41430 WP_003401621.1.41553 WP_003401621.1.41583 WP_003401621.1.41636 WP_003401621.1.41648 WP_003401621.1.41660 WP_003401621.1.41685 WP_003401621.1.41695 WP_003401621.1.41704 WP_003401621.1.4171 WP_003401621.1.41719 WP_003401621.1.41733 WP_003401621.1.41774 WP_003401621.1.41820 WP_003401621.1.41828 WP_003401621.1.41860 WP_003401621.1.41912 WP_003401621.1.41933 WP_003401621.1.41944 WP_003401621.1.42075 WP_003401621.1.42078 WP_003401621.1.42094 WP_003401621.1.42112 WP_003401621.1.4212 WP_003401621.1.42183 WP_003401621.1.42188 WP_003401621.1.42201 WP_003401621.1.42202 WP_003401621.1.42208 WP_003401621.1.42255 WP_003401621.1.42273 WP_003401621.1.42278 WP_003401621.1.42304 WP_003401621.1.42309 WP_003401621.1.42370 WP_003401621.1.42385 WP_003401621.1.42400 WP_003401621.1.42414 WP_003401621.1.42417 WP_003401621.1.42430 WP_003401621.1.42461 WP_003401621.1.42465 WP_003401621.1.42473 WP_003401621.1.42519 WP_003401621.1.42534 WP_003401621.1.4255 WP_003401621.1.42562 WP_003401621.1.42568 WP_003401621.1.42570 WP_003401621.1.42618 WP_003401621.1.42660 WP_003401621.1.42695 WP_003401621.1.42777 WP_003401621.1.42782 WP_003401621.1.42835 WP_003401621.1.42839 WP_003401621.1.42971 WP_003401621.1.43082 WP_003401621.1.43087 WP_003401621.1.43098 WP_003401621.1.43208 WP_003401621.1.43236 WP_003401621.1.43246 WP_003401621.1.43255 WP_003401621.1.43266 WP_003401621.1.43269 WP_003401621.1.43306 WP_003401621.1.4335 WP_003401621.1.43368 WP_003401621.1.43395 WP_003401621.1.43457 WP_003401621.1.43462 WP_003401621.1.43478 WP_003401621.1.43484 WP_003401621.1.43557 WP_003401621.1.43578 WP_003401621.1.43588 WP_003401621.1.43643 WP_003401621.1.43684 WP_003401621.1.43686 WP_003401621.1.43706 WP_003401621.1.43716 WP_003401621.1.43781 WP_003401621.1.43794 WP_003401621.1.43846 WP_003401621.1.43861 WP_003401621.1.43863 WP_003401621.1.43866 WP_003401621.1.43902 WP_003401621.1.43937 WP_003401621.1.43965 WP_003401621.1.4399 WP_003401621.1.43993 WP_003401621.1.43996 WP_003401621.1.44008 WP_003401621.1.44037 WP_003401621.1.44041 WP_003401621.1.44070 WP_003401621.1.44071 WP_003401621.1.44104 WP_003401621.1.44124 WP_003401621.1.44219 WP_003401621.1.44237 WP_003401621.1.44279 WP_003401621.1.44336 WP_003401621.1.44358 WP_003401621.1.4438 WP_003401621.1.44392 WP_003401621.1.4441 WP_003401621.1.44415 WP_003401621.1.44464 WP_003401621.1.44466 WP_003401621.1.44489 WP_003401621.1.44492 WP_003401621.1.44494 WP_003401621.1.44500 WP_003401621.1.44519 WP_003401621.1.44526 WP_003401621.1.44534 WP_003401621.1.44589 WP_003401621.1.44597 WP_003401621.1.44600 WP_003401621.1.44615 WP_003401621.1.44665 WP_003401621.1.44700 WP_003401621.1.44713 WP_003401621.1.44735 WP_003401621.1.44740 WP_003401621.1.44757 WP_003401621.1.44761 WP_003401621.1.44767 WP_003401621.1.44786 WP_003401621.1.44808 WP_003401621.1.44864 WP_003401621.1.44901 WP_003401621.1.44908 WP_003401621.1.44939 WP_003401621.1.45011 WP_003401621.1.4504 WP_003401621.1.45066 WP_003401621.1.45113 WP_003401621.1.45135 WP_003401621.1.45147 WP_003401621.1.45168 WP_003401621.1.4517 WP_003401621.1.45181 WP_003401621.1.45185 WP_003401621.1.45192 WP_003401621.1.45200 WP_003401621.1.45205 WP_003401621.1.45249 WP_003401621.1.4526 WP_003401621.1.45286 WP_003401621.1.45347 WP_003401621.1.45390 WP_003401621.1.454 WP_003401621.1.45453 WP_003401621.1.45460 WP_003401621.1.45463 WP_003401621.1.45470 WP_003401621.1.45491 WP_003401621.1.45563 WP_003401621.1.45584 WP_003401621.1.45590 WP_003401621.1.45666 WP_003401621.1.45697 WP_003401621.1.45731 WP_003401621.1.45743 WP_003401621.1.45765 WP_003401621.1.45776 WP_003401621.1.45783 WP_003401621.1.45815 WP_003401621.1.45849 WP_003401621.1.45867 WP_003401621.1.45884 WP_003401621.1.4590 WP_003401621.1.45923 WP_003401621.1.45926 WP_003401621.1.45989 WP_003401621.1.45992 WP_003401621.1.46025 WP_003401621.1.46090 WP_003401621.1.46100 WP_003401621.1.46101 WP_003401621.1.46103 WP_003401621.1.46107 WP_003401621.1.46127 WP_003401621.1.46128 WP_003401621.1.46141 WP_003401621.1.46150 WP_003401621.1.46201 WP_003401621.1.46226 WP_003401621.1.46253 WP_003401621.1.46268 WP_003401621.1.46285 WP_003401621.1.46300 WP_003401621.1.46313 WP_003401621.1.46365 WP_003401621.1.46370 WP_003401621.1.46381 WP_003401621.1.46402 WP_003401621.1.4644 WP_003401621.1.46453 WP_003401621.1.46463 WP_003401621.1.46478 WP_003401621.1.46492 WP_003401621.1.46521 WP_003401621.1.4653 WP_003401621.1.46532 WP_003401621.1.46539 WP_003401621.1.46585 WP_003401621.1.46609 WP_003401621.1.46613 WP_003401621.1.46674 WP_003401621.1.46724 WP_003401621.1.46773 WP_003401621.1.46777 WP_003401621.1.46786 WP_003401621.1.46847 WP_003401621.1.46851 WP_003401621.1.4687 WP_003401621.1.46897 WP_003401621.1.46936 WP_003401621.1.47011 WP_003401621.1.47012 WP_003401621.1.47077 WP_003401621.1.47083 WP_003401621.1.47106 WP_003401621.1.47142 WP_003401621.1.47147 WP_003401621.1.47166 WP_003401621.1.47178 WP_003401621.1.47179 WP_003401621.1.47210 WP_003401621.1.47261 WP_003401621.1.47262 WP_003401621.1.47402 WP_003401621.1.47423 WP_003401621.1.47467 WP_003401621.1.47502 WP_003401621.1.4751 WP_003401621.1.47511 WP_003401621.1.47568 WP_003401621.1.47588 WP_003401621.1.4764 WP_003401621.1.47681 WP_003401621.1.47690 WP_003401621.1.4771 WP_003401621.1.47717 WP_003401621.1.47743 WP_003401621.1.47754 WP_003401621.1.47773 WP_003401621.1.47776 WP_003401621.1.47780 WP_003401621.1.47847 WP_003401621.1.47858 WP_003401621.1.47868 WP_003401621.1.47893 WP_003401621.1.479 WP_003401621.1.47913 WP_003401621.1.4794 WP_003401621.1.47943 WP_003401621.1.47944 WP_003401621.1.48004 WP_003401621.1.48039 WP_003401621.1.48050 WP_003401621.1.48084 WP_003401621.1.48097 WP_003401621.1.48101 WP_003401621.1.48109 WP_003401621.1.4813 WP_003401621.1.48135 WP_003401621.1.48152 WP_003401621.1.48173 WP_003401621.1.48177 WP_003401621.1.48204 WP_003401621.1.48219 WP_003401621.1.4823 WP_003401621.1.48240 WP_003401621.1.48330 WP_003401621.1.48348 WP_003401621.1.48354 WP_003401621.1.48372 WP_003401621.1.48383 WP_003401621.1.48388 WP_003401621.1.48423 WP_003401621.1.48450 WP_003401621.1.48462 WP_003401621.1.48550 WP_003401621.1.48605 WP_003401621.1.48618 WP_003401621.1.4863 WP_003401621.1.48779 WP_003401621.1.48798 WP_003401621.1.48802 WP_003401621.1.48826 WP_003401621.1.48831 WP_003401621.1.48843 WP_003401621.1.48857 WP_003401621.1.48979 WP_003401621.1.49017 WP_003401621.1.49048 WP_003401621.1.49059 WP_003401621.1.4906 WP_003401621.1.4907 WP_003401621.1.49103 WP_003401621.1.49110 WP_003401621.1.49111 WP_003401621.1.49112 WP_003401621.1.49254 WP_003401621.1.49263 WP_003401621.1.49296 WP_003401621.1.49337 WP_003401621.1.49419 WP_003401621.1.49426 WP_003401621.1.49439 WP_003401621.1.49474 WP_003401621.1.49516 WP_003401621.1.49523 WP_003401621.1.49526 WP_003401621.1.49532 WP_003401621.1.49588 WP_003401621.1.49678 WP_003401621.1.49709 WP_003401621.1.4971 WP_003401621.1.4972 WP_003401621.1.49736 WP_003401621.1.49746 WP_003401621.1.49764 WP_003401621.1.49773 WP_003401621.1.49814 WP_003401621.1.49815 WP_003401621.1.49816 WP_003401621.1.49839 WP_003401621.1.49857 WP_003401621.1.49878 WP_003401621.1.49880 WP_003401621.1.49944 WP_003401621.1.49990 WP_003401621.1.50077 WP_003401621.1.50081 WP_003401621.1.50122 WP_003401621.1.50149 WP_003401621.1.5018 WP_003401621.1.50194 WP_003401621.1.50218 WP_003401621.1.50249 WP_003401621.1.50271 WP_003401621.1.50324 WP_003401621.1.50372 WP_003401621.1.50398 WP_003401621.1.50444 WP_003401621.1.50466 WP_003401621.1.50472 WP_003401621.1.50498 WP_003401621.1.5050 WP_003401621.1.50540 WP_003401621.1.50554 WP_003401621.1.50557 WP_003401621.1.50601 WP_003401621.1.50610 WP_003401621.1.50633 WP_003401621.1.50659 WP_003401621.1.50683 WP_003401621.1.50689 WP_003401621.1.50692 WP_003401621.1.50714 WP_003401621.1.50729 WP_003401621.1.50794 WP_003401621.1.50841 WP_003401621.1.50860 WP_003401621.1.50868 WP_003401621.1.50877 WP_003401621.1.5096 WP_003401621.1.50981 WP_003401621.1.50987 WP_003401621.1.51003 WP_003401621.1.51082 WP_003401621.1.51101 WP_003401621.1.51116 WP_003401621.1.51149 WP_003401621.1.51156 WP_003401621.1.51157 WP_003401621.1.51213 WP_003401621.1.51232 WP_003401621.1.51239 WP_003401621.1.51247 WP_003401621.1.51279 WP_003401621.1.51291 WP_003401621.1.51301 WP_003401621.1.51329 WP_003401621.1.51391 WP_003401621.1.51422 WP_003401621.1.51468 WP_003401621.1.51478 WP_003401621.1.51593 WP_003401621.1.51628 WP_003401621.1.5164 WP_003401621.1.51647 WP_003401621.1.51660 WP_003401621.1.51721 WP_003401621.1.51788 WP_003401621.1.51801 WP_003401621.1.51817 WP_003401621.1.51819 WP_003401621.1.51854 WP_003401621.1.51923 WP_003401621.1.51942 WP_003401621.1.51948 WP_003401621.1.51963 WP_003401621.1.51969 WP_003401621.1.52001 WP_003401621.1.52036 WP_003401621.1.52038 WP_003401621.1.52046 WP_003401621.1.52059 WP_003401621.1.52069 WP_003401621.1.52166 WP_003401621.1.52168 WP_003401621.1.52173 WP_003401621.1.52216 WP_003401621.1.52238 WP_003401621.1.52241 WP_003401621.1.52280 WP_003401621.1.52314 WP_003401621.1.52385 WP_003401621.1.52460 WP_003401621.1.52485 WP_003401621.1.52486 WP_003401621.1.52495 WP_003401621.1.52504 WP_003401621.1.52522 WP_003401621.1.52531 WP_003401621.1.52563 WP_003401621.1.52564 WP_003401621.1.52673 WP_003401621.1.52674 WP_003401621.1.52708 WP_003401621.1.52713 WP_003401621.1.52761 WP_003401621.1.52778 WP_003401621.1.52791 WP_003401621.1.52797 WP_003401621.1.52818 WP_003401621.1.52873 WP_003401621.1.52909 WP_003401621.1.52998 WP_003401621.1.53056 WP_003401621.1.5306 WP_003401621.1.53088 WP_003401621.1.53117 WP_003401621.1.53118 WP_003401621.1.53142 WP_003401621.1.53143 WP_003401621.1.53167 WP_003401621.1.53200 WP_003401621.1.53204 WP_003401621.1.53226 WP_003401621.1.53237 WP_003401621.1.5327 WP_003401621.1.53276 WP_003401621.1.53302 WP_003401621.1.5334 WP_003401621.1.5335 WP_003401621.1.53413 WP_003401621.1.53458 WP_003401621.1.53460 WP_003401621.1.53522 WP_003401621.1.53525 WP_003401621.1.53526 WP_003401621.1.53553 WP_003401621.1.53609 WP_003401621.1.53628 WP_003401621.1.53667 WP_003401621.1.53679 WP_003401621.1.53715 WP_003401621.1.53742 WP_003401621.1.53743 WP_003401621.1.53775 WP_003401621.1.53818 WP_003401621.1.53822 WP_003401621.1.53853 WP_003401621.1.53865 WP_003401621.1.53900 WP_003401621.1.53912 WP_003401621.1.53914 WP_003401621.1.5398 WP_003401621.1.5408 WP_003401621.1.54089 WP_003401621.1.54093 WP_003401621.1.54099 WP_003401621.1.54112 WP_003401621.1.54125 WP_003401621.1.54141 WP_003401621.1.54206 WP_003401621.1.54218 WP_003401621.1.54225 WP_003401621.1.54227 WP_003401621.1.54232 WP_003401621.1.54241 WP_003401621.1.54245 WP_003401621.1.54247 WP_003401621.1.54260 WP_003401621.1.54280 WP_003401621.1.5429 WP_003401621.1.54294 WP_003401621.1.54314 WP_003401621.1.54347 WP_003401621.1.54351 WP_003401621.1.54370 WP_003401621.1.54428 WP_003401621.1.54449 WP_003401621.1.54494 WP_003401621.1.54502 WP_003401621.1.54514 WP_003401621.1.54519 WP_003401621.1.5452 WP_003401621.1.54555 WP_003401621.1.54575 WP_003401621.1.54633 WP_003401621.1.54686 WP_003401621.1.54687 WP_003401621.1.54730 WP_003401621.1.5475 WP_003401621.1.54797 WP_003401621.1.54807 WP_003401621.1.54838 WP_003401621.1.54905 WP_003401621.1.54937 WP_003401621.1.54939 WP_003401621.1.54944 WP_003401621.1.54945 WP_003401621.1.55015 WP_003401621.1.55022 WP_003401621.1.55051 WP_003401621.1.55072 WP_003401621.1.55106 WP_003401621.1.55126 WP_003401621.1.55248 WP_003401621.1.55258 WP_003401621.1.55267 WP_003401621.1.55279 WP_003401621.1.55326 WP_003401621.1.5533 WP_003401621.1.55396 WP_003401621.1.55398 WP_003401621.1.55441 WP_003401621.1.55459 WP_003401621.1.55501 WP_003401621.1.55504 WP_003401621.1.55641 WP_003401621.1.5569 WP_003401621.1.55735 WP_003401621.1.55772 WP_003401621.1.55802 WP_003401621.1.55807 WP_003401621.1.55821 WP_003401621.1.5583 WP_003401621.1.55856 WP_003401621.1.55860 WP_003401621.1.55883 WP_003401621.1.55902 WP_003401621.1.55908 WP_003401621.1.5591 WP_003401621.1.55961 WP_003401621.1.55977 WP_003401621.1.55983 WP_003401621.1.56028 WP_003401621.1.56060 WP_003401621.1.56107 WP_003401621.1.56132 WP_003401621.1.56163 WP_003401621.1.56167 WP_003401621.1.56287 WP_003401621.1.56327 WP_003401621.1.56341 WP_003401621.1.56359 WP_003401621.1.56394 WP_003401621.1.56443 WP_003401621.1.56500 WP_003401621.1.56517 WP_003401621.1.5656 WP_003401621.1.56593 WP_003401621.1.56625 WP_003401621.1.56637 WP_003401621.1.56670 WP_003401621.1.56697 WP_003401621.1.56709 WP_003401621.1.56729 WP_003401621.1.56755 WP_003401621.1.56764 WP_003401621.1.56769 WP_003401621.1.56795 WP_003401621.1.5681 WP_003401621.1.56839 WP_003401621.1.56915 WP_003401621.1.56961 WP_003401621.1.56971 WP_003401621.1.56972 WP_003401621.1.57035 WP_003401621.1.57077 WP_003401621.1.57087 WP_003401621.1.57151 WP_003401621.1.57169 WP_003401621.1.57208 WP_003401621.1.57212 WP_003401621.1.57230 WP_003401621.1.5727 WP_003401621.1.57273 WP_003401621.1.573 WP_003401621.1.57314 WP_003401621.1.57351 WP_003401621.1.57352 WP_003401621.1.57430 WP_003401621.1.5744 WP_003401621.1.5745 WP_003401621.1.57461 WP_003401621.1.57469 WP_003401621.1.57489 WP_003401621.1.57509 WP_003401621.1.57525 WP_003401621.1.57551 WP_003401621.1.5758 WP_003401621.1.57596 WP_003401621.1.57604 WP_003401621.1.57616 WP_003401621.1.57617 WP_003401621.1.57619 WP_003401621.1.57642 WP_003401621.1.57658 WP_003401621.1.57667 WP_003401621.1.57675 WP_003401621.1.57708 WP_003401621.1.57794 WP_003401621.1.57843 WP_003401621.1.57906 WP_003401621.1.57926 WP_003401621.1.57930 WP_003401621.1.57957 WP_003401621.1.57960 WP_003401621.1.57964 WP_003401621.1.58000 WP_003401621.1.58086 WP_003401621.1.58101 WP_003401621.1.58108 WP_003401621.1.58121 WP_003401621.1.58164 WP_003401621.1.582 WP_003401621.1.58202 WP_003401621.1.58209 WP_003401621.1.58215 WP_003401621.1.58250 WP_003401621.1.58259 WP_003401621.1.58283 WP_003401621.1.58288 WP_003401621.1.5830 WP_003401621.1.58303 WP_003401621.1.58311 WP_003401621.1.58359 WP_003401621.1.58431 WP_003401621.1.58457 WP_003401621.1.58488 WP_003401621.1.58518 WP_003401621.1.58534 WP_003401621.1.58567 WP_003401621.1.58573 WP_003401621.1.58602 WP_003401621.1.5865 WP_003401621.1.58671 WP_003401621.1.58690 WP_003401621.1.58702 WP_003401621.1.58743 WP_003401621.1.58754 WP_003401621.1.5881 WP_003401621.1.58848 WP_003401621.1.58857 WP_003401621.1.58891 WP_003401621.1.58892 WP_003401621.1.5890 WP_003401621.1.58904 WP_003401621.1.58921 WP_003401621.1.58930 WP_003401621.1.58939 WP_003401621.1.58941 WP_003401621.1.58953 WP_003401621.1.58961 WP_003401621.1.5898 WP_003401621.1.59025 WP_003401621.1.59029 WP_003401621.1.59037 WP_003401621.1.59044 WP_003401621.1.59085 WP_003401621.1.59088 WP_003401621.1.59130 WP_003401621.1.5914 WP_003401621.1.59147 WP_003401621.1.59209 WP_003401621.1.59240 WP_003401621.1.59253 WP_003401621.1.59254 WP_003401621.1.59262 WP_003401621.1.5928 WP_003401621.1.59304 WP_003401621.1.59316 WP_003401621.1.59326 WP_003401621.1.59328 WP_003401621.1.59388 WP_003401621.1.59428 WP_003401621.1.59537 WP_003401621.1.59677 WP_003401621.1.59727 WP_003401621.1.59738 WP_003401621.1.59757 WP_003401621.1.59808 WP_003401621.1.59850 WP_003401621.1.59856 WP_003401621.1.59861 WP_003401621.1.5987 WP_003401621.1.59878 WP_003401621.1.59888 WP_003401621.1.5996 WP_003401621.1.60007 WP_003401621.1.60016 WP_003401621.1.6003 WP_003401621.1.60047 WP_003401621.1.6007 WP_003401621.1.60121 WP_003401621.1.60135 WP_003401621.1.60139 WP_003401621.1.60152 WP_003401621.1.60197 WP_003401621.1.60205 WP_003401621.1.60215 WP_003401621.1.60217 WP_003401621.1.60267 WP_003401621.1.60288 WP_003401621.1.60301 WP_003401621.1.60305 WP_003401621.1.60312 WP_003401621.1.60313 WP_003401621.1.60314 WP_003401621.1.60367 WP_003401621.1.60376 WP_003401621.1.60403 WP_003401621.1.60413 WP_003401621.1.60421 WP_003401621.1.60451 WP_003401621.1.60460 WP_003401621.1.60479 WP_003401621.1.60512 WP_003401621.1.60573 WP_003401621.1.60583 WP_003401621.1.60632 WP_003401621.1.60657 WP_003401621.1.60687 WP_003401621.1.60689 WP_003401621.1.60727 WP_003401621.1.60738 WP_003401621.1.60763 WP_003401621.1.60791 WP_003401621.1.60834 WP_003401621.1.60870 WP_003401621.1.60878 WP_003401621.1.60879 WP_003401621.1.60913 WP_003401621.1.60978 WP_003401621.1.61000 WP_003401621.1.61001 WP_003401621.1.61012 WP_003401621.1.61052 WP_003401621.1.61065 WP_003401621.1.61100 WP_003401621.1.61101 WP_003401621.1.61142 WP_003401621.1.61198 WP_003401621.1.61234 WP_003401621.1.61256 WP_003401621.1.61281 WP_003401621.1.61368 WP_003401621.1.61409 WP_003401621.1.61420 WP_003401621.1.61422 WP_003401621.1.61428 WP_003401621.1.61469 WP_003401621.1.61494 WP_003401621.1.61522 WP_003401621.1.61552 WP_003401621.1.61567 WP_003401621.1.61573 WP_003401621.1.61584 WP_003401621.1.61586 WP_003401621.1.6159 WP_003401621.1.6160 WP_003401621.1.61614 WP_003401621.1.6163 WP_003401621.1.61655 WP_003401621.1.61669 WP_003401621.1.61682 WP_003401621.1.61692 WP_003401621.1.61728 WP_003401621.1.61750 WP_003401621.1.61754 WP_003401621.1.61755 WP_003401621.1.61757 WP_003401621.1.61778 WP_003401621.1.61793 WP_003401621.1.61842 WP_003401621.1.61850 WP_003401621.1.61868 WP_003401621.1.61911 WP_003401621.1.61925 WP_003401621.1.61941 WP_003401621.1.61953 WP_003401621.1.61979 WP_003401621.1.61986 WP_003401621.1.62087 WP_003401621.1.62089 WP_003401621.1.62104 WP_003401621.1.6211 WP_003401621.1.62162 WP_003401621.1.62225 WP_003401621.1.62230 WP_003401621.1.62249 WP_003401621.1.62270 WP_003401621.1.62281 WP_003401621.1.62307 WP_003401621.1.6231 WP_003401621.1.62359 WP_003401621.1.62360 WP_003401621.1.62371 WP_003401621.1.62379 WP_003401621.1.62395 WP_003401621.1.62408 WP_003401621.1.62449 WP_003401621.1.62468 WP_003401621.1.62508 WP_003401621.1.62565 WP_003401621.1.62606 WP_003401621.1.62666 WP_003401621.1.62687 WP_003401621.1.62715 WP_003401621.1.62738 WP_003401621.1.62761 WP_003401621.1.62786 WP_003401621.1.62813 WP_003401621.1.62839 WP_003401621.1.62841 WP_003401621.1.62909 WP_003401621.1.6294 WP_003401621.1.62962 WP_003401621.1.63007 WP_003401621.1.63019 WP_003401621.1.63032 WP_003401621.1.63064 WP_003401621.1.63066 WP_003401621.1.63072 WP_003401621.1.6308 WP_003401621.1.63081 WP_003401621.1.63096 WP_003401621.1.63106 WP_003401621.1.63154 WP_003401621.1.63161 WP_003401621.1.63175 WP_003401621.1.6322 WP_003401621.1.63222 WP_003401621.1.63247 WP_003401621.1.63291 WP_003401621.1.63312 WP_003401621.1.63317 WP_003401621.1.63331 WP_003401621.1.63373 WP_003401621.1.63384 WP_003401621.1.63403 WP_003401621.1.63424 WP_003401621.1.63428 WP_003401621.1.63464 WP_003401621.1.63502 WP_003401621.1.63504 WP_003401621.1.63530 WP_003401621.1.63538 WP_003401621.1.63564 WP_003401621.1.63567 WP_003401621.1.63596 WP_003401621.1.63627 WP_003401621.1.63654 WP_003401621.1.63662 WP_003401621.1.63711 WP_003401621.1.63819 WP_003401621.1.63844 WP_003401621.1.63913 WP_003401621.1.63915 WP_003401621.1.63918 WP_003401621.1.64000 WP_003401621.1.64027 WP_003401621.1.64082 WP_003401621.1.64091 WP_003401621.1.64102 WP_003401621.1.64104 WP_003401621.1.64119 WP_003401621.1.64169 WP_003401621.1.64219 WP_003401621.1.6422 WP_003401621.1.64222 WP_003401621.1.64223 WP_003401621.1.64235 WP_003401621.1.6427 WP_003401621.1.64278 WP_003401621.1.64287 WP_003401621.1.64414 WP_003401621.1.64419 WP_003401621.1.6443 WP_003401621.1.64463 WP_003401621.1.64506 WP_003401621.1.64511 WP_003401621.1.64514 WP_003401621.1.64515 WP_003401621.1.64522 WP_003401621.1.64526 WP_003401621.1.64543 WP_003401621.1.6456 WP_003401621.1.64588 WP_003401621.1.64589 WP_003401621.1.64594 WP_003401621.1.64595 WP_003401621.1.64608 WP_003401621.1.64629 WP_003401621.1.64664 WP_003401621.1.64669 WP_003401621.1.64680 WP_003401621.1.64682 WP_003401621.1.64727 WP_003401621.1.64774 WP_003401621.1.64802 WP_003401621.1.6486 WP_003401621.1.64870 WP_003401621.1.64898 WP_003401621.1.64922 WP_003401621.1.64924 WP_003401621.1.6493 WP_003401621.1.64937 WP_003401621.1.64941 WP_003401621.1.64966 WP_003401621.1.64973 WP_003401621.1.65001 WP_003401621.1.65026 WP_003401621.1.65053 WP_003401621.1.65102 WP_003401621.1.65157 WP_003401621.1.65181 WP_003401621.1.65212 WP_003401621.1.65229 WP_003401621.1.6523 WP_003401621.1.65253 WP_003401621.1.65329 WP_003401621.1.6536 WP_003401621.1.65374 WP_003401621.1.65414 WP_003401621.1.65455 WP_003401621.1.65467 WP_003401621.1.65488 WP_003401621.1.65583 WP_003401621.1.65623 WP_003401621.1.65635 WP_003401621.1.65648 WP_003401621.1.65683 WP_003401621.1.65686 WP_003401621.1.65688 WP_003401621.1.65707 WP_003401621.1.65747 WP_003401621.1.65816 WP_003401621.1.65830 WP_003401621.1.65862 WP_003401621.1.65929 WP_003401621.1.65932 WP_003401621.1.65974 WP_003401621.1.66004 WP_003401621.1.66013 WP_003401621.1.66089 WP_003401621.1.66149 WP_003401621.1.66229 WP_003401621.1.66276 WP_003401621.1.66297 WP_003401621.1.66323 WP_003401621.1.66325 WP_003401621.1.66334 WP_003401621.1.66355 WP_003401621.1.66394 WP_003401621.1.66455 WP_003401621.1.66460 WP_003401621.1.66464 WP_003401621.1.66466 WP_003401621.1.66487 WP_003401621.1.66544 WP_003401621.1.66558 WP_003401621.1.66580 WP_003401621.1.66582 WP_003401621.1.66612 WP_003401621.1.66615 WP_003401621.1.66656 WP_003401621.1.66663 WP_003401621.1.66675 WP_003401621.1.66715 WP_003401621.1.66718 WP_003401621.1.66817 WP_003401621.1.66826 WP_003401621.1.66842 WP_003401621.1.66868 WP_003401621.1.66878 WP_003401621.1.66880 WP_003401621.1.66961 WP_003401621.1.67005 WP_003401621.1.6704 WP_003401621.1.67044 WP_003401621.1.67061 WP_003401621.1.67089 WP_003401621.1.67098 WP_003401621.1.67146 WP_003401621.1.67170 WP_003401621.1.67198 WP_003401621.1.6720 WP_003401621.1.67207 WP_003401621.1.67220 WP_003401621.1.67225 WP_003401621.1.67231 WP_003401621.1.6724 WP_003401621.1.67257 WP_003401621.1.67298 WP_003401621.1.67307 WP_003401621.1.67332 WP_003401621.1.67354 WP_003401621.1.67381 WP_003401621.1.67396 WP_003401621.1.67417 WP_003401621.1.67422 WP_003401621.1.67453 WP_003401621.1.67459 WP_003401621.1.6746 WP_003401621.1.67473 WP_003401621.1.67481 WP_003401621.1.67482 WP_003401621.1.67496 WP_003401621.1.67516 WP_003401621.1.67523 WP_003401621.1.67536 WP_003401621.1.67575 WP_003401621.1.67587 WP_003401621.1.67600 WP_003401621.1.67602 WP_003401621.1.67630 WP_003401621.1.67692 WP_003401621.1.67744 WP_003401621.1.6775 WP_003401621.1.67750 WP_003401621.1.6777 WP_003401621.1.67809 WP_003401621.1.67870 WP_003401621.1.67888 WP_003401621.1.67915 WP_003401621.1.67980 WP_003401621.1.67982 WP_003401621.1.68022 WP_003401621.1.68029 WP_003401621.1.68057 WP_003401621.1.68083 WP_003401621.1.68088 WP_003401621.1.68110 WP_003401621.1.68153 WP_003401621.1.68164 WP_003401621.1.68169 WP_003401621.1.68193 WP_003401621.1.68212 WP_003401621.1.6825 WP_003401621.1.68297 WP_003401621.1.68325 WP_003401621.1.68340 WP_003401621.1.68384 WP_003401621.1.68388 WP_003401621.1.68429 WP_003401621.1.6843 WP_003401621.1.68444 WP_003401621.1.68465 WP_003401621.1.68518 WP_003401621.1.68569 WP_003401621.1.68623 WP_003401621.1.68624 WP_003401621.1.68637 WP_003401621.1.68646 WP_003401621.1.68667 WP_003401621.1.68669 WP_003401621.1.68672 WP_003401621.1.68704 WP_003401621.1.68708 WP_003401621.1.6872 WP_003401621.1.68730 WP_003401621.1.68734 WP_003401621.1.68748 WP_003401621.1.68754 WP_003401621.1.68761 WP_003401621.1.68763 WP_003401621.1.68766 WP_003401621.1.68774 WP_003401621.1.68796 WP_003401621.1.68824 WP_003401621.1.68832 WP_003401621.1.68833 WP_003401621.1.68841 WP_003401621.1.68859 WP_003401621.1.68876 WP_003401621.1.68916 WP_003401621.1.68923 WP_003401621.1.6896 WP_003401621.1.68981 WP_003401621.1.68984 WP_003401621.1.69008 WP_003401621.1.69076 WP_003401621.1.69079 WP_003401621.1.69082 WP_003401621.1.69178 WP_003401621.1.69181 WP_003401621.1.69231 WP_003401621.1.69256 WP_003401621.1.69311 WP_003401621.1.69315 WP_003401621.1.69322 WP_003401621.1.69342 WP_003401621.1.6935 WP_003401621.1.6936 WP_003401621.1.69369 WP_003401621.1.69374 WP_003401621.1.69426 WP_003401621.1.69427 WP_003401621.1.69429 WP_003401621.1.6951 WP_003401621.1.69511 WP_003401621.1.69526 WP_003401621.1.69547 WP_003401621.1.69573 WP_003401621.1.6960 WP_003401621.1.69617 WP_003401621.1.69634 WP_003401621.1.69647 WP_003401621.1.69659 WP_003401621.1.69673 WP_003401621.1.69684 WP_003401621.1.69686 WP_003401621.1.69707 WP_003401621.1.69709 WP_003401621.1.69723 WP_003401621.1.69800 WP_003401621.1.69802 WP_003401621.1.69870 WP_003401621.1.69873 WP_003401621.1.69898 WP_003401621.1.69913 WP_003401621.1.69925 WP_003401621.1.69931 WP_003401621.1.69938 WP_003401621.1.69955 WP_003401621.1.69957 WP_003401621.1.69981 WP_003401621.1.69990 WP_003401621.1.70 WP_003401621.1.70032 WP_003401621.1.70062 WP_003401621.1.70072 WP_003401621.1.70131 WP_003401621.1.70132 WP_003401621.1.7022 WP_003401621.1.70227 WP_003401621.1.70274 WP_003401621.1.7029 WP_003401621.1.70325 WP_003401621.1.70328 WP_003401621.1.70356 WP_003401621.1.70369 WP_003401621.1.70418 WP_003401621.1.70422 WP_003401621.1.70435 WP_003401621.1.70463 WP_003401621.1.70480 WP_003401621.1.70494 WP_003401621.1.70498 WP_003401621.1.70505 WP_003401621.1.70573 WP_003401621.1.70577 WP_003401621.1.70610 WP_003401621.1.70615 WP_003401621.1.70618 WP_003401621.1.70622 WP_003401621.1.70626 WP_003401621.1.70704 WP_003401621.1.70729 WP_003401621.1.70782 WP_003401621.1.70830 WP_003401621.1.70840 WP_003401621.1.70871 WP_003401621.1.70915 WP_003401621.1.70955 WP_003401621.1.70958 WP_003401621.1.70964 WP_003401621.1.70976 WP_003401621.1.71026 WP_003401621.1.71063 WP_003401621.1.71076 WP_003401621.1.7111 WP_003401621.1.71118 WP_003401621.1.71128 WP_003401621.1.71187 WP_003401621.1.71255 WP_003401621.1.71258 WP_003401621.1.71259 WP_003401621.1.71326 WP_003401621.1.71331 WP_003401621.1.71344 WP_003401621.1.71390 WP_003401621.1.71414 WP_003401621.1.71440 WP_003401621.1.71457 WP_003401621.1.7146 WP_003401621.1.71490 WP_003401621.1.71492 WP_003401621.1.71509 WP_003401621.1.71516 WP_003401621.1.71517 WP_003401621.1.71527 WP_003401621.1.71532 WP_003401621.1.71545 WP_003401621.1.71546 WP_003401621.1.71569 WP_003401621.1.71604 WP_003401621.1.71621 WP_003401621.1.71630 WP_003401621.1.71654 WP_003401621.1.71664 WP_003401621.1.71718 WP_003401621.1.71781 WP_003401621.1.71820 WP_003401621.1.71847 WP_003401621.1.71871 WP_003401621.1.71909 WP_003401621.1.71957 WP_003401621.1.71970 WP_003401621.1.72047 WP_003401621.1.72062 WP_003401621.1.72111 WP_003401621.1.72122 WP_003401621.1.72128 WP_003401621.1.72143 WP_003401621.1.7216 WP_003401621.1.72209 WP_003401621.1.72218 WP_003401621.1.72227 WP_003401621.1.7224 WP_003401621.1.72332 WP_003401621.1.72380 WP_003401621.1.72405 WP_003401621.1.72420 WP_003401621.1.72451 WP_003401621.1.72452 WP_003401621.1.72457 WP_003401621.1.72459 WP_003401621.1.72466 WP_003401621.1.72487 WP_003401621.1.72488 WP_003401621.1.72506 WP_003401621.1.72543 WP_003401621.1.7256 WP_003401621.1.72585 WP_003401621.1.72591 WP_003401621.1.72592 WP_003401621.1.72640 WP_003401621.1.7266 WP_003401621.1.72661 WP_003401621.1.72684 WP_003401621.1.72739 WP_003401621.1.72744 WP_003401621.1.72755 WP_003401621.1.72759 WP_003401621.1.72784 WP_003401621.1.72792 WP_003401621.1.72826 WP_003401621.1.72831 WP_003401621.1.72852 WP_003401621.1.72879 WP_003401621.1.72954 WP_003401621.1.72957 WP_003401621.1.72959 WP_003401621.1.72973 WP_003401621.1.7298 WP_003401621.1.72982 WP_003401621.1.72988 WP_003401621.1.72993 WP_003401621.1.73028 WP_003401621.1.73042 WP_003401621.1.73045 WP_003401621.1.73092 WP_003401621.1.73118 WP_003401621.1.7312 WP_003401621.1.73127 WP_003401621.1.73134 WP_003401621.1.73150 WP_003401621.1.73154 WP_003401621.1.73163 WP_003401621.1.73205 WP_003401621.1.73310 WP_003401621.1.73315 WP_003401621.1.73365 WP_003401621.1.73391 WP_003401621.1.73404 WP_003401621.1.73424 WP_003401621.1.73445 WP_003401621.1.73453 WP_003401621.1.73465 WP_003401621.1.73466 WP_003401621.1.73471 WP_003401621.1.73478 WP_003401621.1.73482 WP_003401621.1.73507 WP_003401621.1.73532 WP_003401621.1.73550 WP_003401621.1.73564 WP_003401621.1.73623 WP_003401621.1.73644 WP_003401621.1.7366 WP_003401621.1.73688 WP_003401621.1.73750 WP_003401621.1.73774 WP_003401621.1.7379 WP_003401621.1.73813 WP_003401621.1.73840 WP_003401621.1.73876 WP_003401621.1.7389 WP_003401621.1.73986 WP_003401621.1.74016 WP_003401621.1.74039 WP_003401621.1.74101 WP_003401621.1.74107 WP_003401621.1.74120 WP_003401621.1.74144 WP_003401621.1.7417 WP_003401621.1.74190 WP_003401621.1.7423 WP_003401621.1.74262 WP_003401621.1.74269 WP_003401621.1.74291 WP_003401621.1.74296 WP_003401621.1.7436 WP_003401621.1.74378 WP_003401621.1.74382 WP_003401621.1.74395 WP_003401621.1.74400 WP_003401621.1.74401 WP_003401621.1.74432 WP_003401621.1.74477 WP_003401621.1.74487 WP_003401621.1.74504 WP_003401621.1.74551 WP_003401621.1.74628 WP_003401621.1.74641 WP_003401621.1.74653 WP_003401621.1.74660 WP_003401621.1.74786 WP_003401621.1.74820 WP_003401621.1.74870 WP_003401621.1.74881 WP_003401621.1.74888 WP_003401621.1.74952 WP_003401621.1.75043 WP_003401621.1.75045 WP_003401621.1.75055 WP_003401621.1.75078 WP_003401621.1.75081 WP_003401621.1.75120 WP_003401621.1.75163 WP_003401621.1.75188 WP_003401621.1.75200 WP_003401621.1.75202 WP_003401621.1.75239 WP_003401621.1.75250 WP_003401621.1.75263 WP_003401621.1.75281 WP_003401621.1.7535 WP_003401621.1.75376 WP_003401621.1.75391 WP_003401621.1.75441 WP_003401621.1.75581 WP_003401621.1.75635 WP_003401621.1.75645 WP_003401621.1.75741 WP_003401621.1.75772 WP_003401621.1.75774 WP_003401621.1.75811 WP_003401621.1.75833 WP_003401621.1.7585 WP_003401621.1.75864 WP_003401621.1.75868 WP_003401621.1.75968 WP_003401621.1.75974 WP_003401621.1.76007 WP_003401621.1.76016 WP_003401621.1.76032 WP_003401621.1.76037 WP_003401621.1.7604 WP_003401621.1.76064 WP_003401621.1.76110 WP_003401621.1.76133 WP_003401621.1.76138 WP_003401621.1.76177 WP_003401621.1.76183 WP_003401621.1.76209 WP_003401621.1.76277 WP_003401621.1.76280 WP_003401621.1.76281 WP_003401621.1.76291 WP_003401621.1.76297 WP_003401621.1.76360 WP_003401621.1.76379 WP_003401621.1.76413 WP_003401621.1.76414 WP_003401621.1.76427 WP_003401621.1.76436 WP_003401621.1.76442 WP_003401621.1.76443 WP_003401621.1.76456 WP_003401621.1.76521 WP_003401621.1.76533 WP_003401621.1.76625 WP_003401621.1.76629 WP_003401621.1.76635 WP_003401621.1.76638 WP_003401621.1.76639 WP_003401621.1.76678 WP_003401621.1.76750 WP_003401621.1.76754 WP_003401621.1.76781 WP_003401621.1.76818 WP_003401621.1.76824 WP_003401621.1.76835 WP_003401621.1.76873 WP_003401621.1.76881 WP_003401621.1.76900 WP_003401621.1.7691 WP_003401621.1.76947 WP_003401621.1.76954 WP_003401621.1.76955 WP_003401621.1.76976 WP_003401621.1.77000 WP_003401621.1.77021 WP_003401621.1.77056 WP_003401621.1.77065 WP_003401621.1.77075 WP_003401621.1.77093 WP_003401621.1.77107 WP_003401621.1.77115 WP_003401621.1.77118 WP_003401621.1.77141 WP_003401621.1.77142 WP_003401621.1.77166 WP_003401621.1.77250 WP_003401621.1.77252 WP_003401621.1.77266 WP_003401621.1.77280 WP_003401621.1.77285 WP_003401621.1.77312 WP_003401621.1.77348 WP_003401621.1.77351 WP_003401621.1.77352 WP_003401621.1.77361 WP_003401621.1.774 WP_003401621.1.7740 WP_003401621.1.77425 WP_003401621.1.77463 WP_003401621.1.7748 WP_003401621.1.77530 WP_003401621.1.77559 WP_003401621.1.77599 WP_003401621.1.77605 WP_003401621.1.7762 WP_003401621.1.77627 WP_003401621.1.77649 WP_003401621.1.77667 WP_003401621.1.77704 WP_003401621.1.77726 WP_003401621.1.77774 WP_003401621.1.7778 WP_003401621.1.77790 WP_003401621.1.77809 WP_003401621.1.77843 WP_003401621.1.77865 WP_003401621.1.77879 WP_003401621.1.77890 WP_003401621.1.77909 WP_003401621.1.77931 WP_003401621.1.77984 WP_003401621.1.78020 WP_003401621.1.78024 WP_003401621.1.78084 WP_003401621.1.78086 WP_003401621.1.7809 WP_003401621.1.78105 WP_003401621.1.78136 WP_003401621.1.78162 WP_003401621.1.7817 WP_003401621.1.78236 WP_003401621.1.78238 WP_003401621.1.78338 WP_003401621.1.7836 WP_003401621.1.78360 WP_003401621.1.78429 WP_003401621.1.78459 WP_003401621.1.78488 WP_003401621.1.7849 WP_003401621.1.78516 WP_003401621.1.78524 WP_003401621.1.78538 WP_003401621.1.78574 WP_003401621.1.78580 WP_003401621.1.7860 WP_003401621.1.78620 WP_003401621.1.78646 WP_003401621.1.78648 WP_003401621.1.78655 WP_003401621.1.78657 WP_003401621.1.78659 WP_003401621.1.7869 WP_003401621.1.78692 WP_003401621.1.78760 WP_003401621.1.78766 WP_003401621.1.78776 WP_003401621.1.78778 WP_003401621.1.78784 WP_003401621.1.78788 WP_003401621.1.78790 WP_003401621.1.78793 WP_003401621.1.78848 WP_003401621.1.78860 WP_003401621.1.7887 WP_003401621.1.78884 WP_003401621.1.78969 WP_003401621.1.78977 WP_003401621.1.79005 WP_003401621.1.79064 WP_003401621.1.79068 WP_003401621.1.79077 WP_003401621.1.79095 WP_003401621.1.79112 WP_003401621.1.79145 WP_003401621.1.79152 WP_003401621.1.79163 WP_003401621.1.79182 WP_003401621.1.79198 WP_003401621.1.79218 WP_003401621.1.79268 WP_003401621.1.79273 WP_003401621.1.79290 WP_003401621.1.79319 WP_003401621.1.79325 WP_003401621.1.79326 WP_003401621.1.7933 WP_003401621.1.79394 WP_003401621.1.79413 WP_003401621.1.79422 WP_003401621.1.79447 WP_003401621.1.79455 WP_003401621.1.79471 WP_003401621.1.79480 WP_003401621.1.79482 WP_003401621.1.79488 WP_003401621.1.79565 WP_003401621.1.79588 WP_003401621.1.79698 WP_003401621.1.797 WP_003401621.1.79744 WP_003401621.1.79784 WP_003401621.1.79802 WP_003401621.1.79806 WP_003401621.1.79819 WP_003401621.1.79828 WP_003401621.1.79851 WP_003401621.1.79853 WP_003401621.1.79881 WP_003401621.1.79898 WP_003401621.1.7990 WP_003401621.1.79913 WP_003401621.1.79918 WP_003401621.1.79947 WP_003401621.1.79948 WP_003401621.1.7995 WP_003401621.1.7997 WP_003401621.1.80004 WP_003401621.1.80015 WP_003401621.1.80054 WP_003401621.1.80084 WP_003401621.1.80234 WP_003401621.1.8026 WP_003401621.1.80275 WP_003401621.1.80299 WP_003401621.1.80300 WP_003401621.1.80326 WP_003401621.1.80351 WP_003401621.1.80370 WP_003401621.1.80399 WP_003401621.1.80451 WP_003401621.1.80458 WP_003401621.1.80461 WP_003401621.1.80490 WP_003401621.1.80503 WP_003401621.1.80552 WP_003401621.1.80576 WP_003401621.1.80588 WP_003401621.1.80599 WP_003401621.1.8060 WP_003401621.1.80624 WP_003401621.1.80636 WP_003401621.1.80711 WP_003401621.1.80714 WP_003401621.1.80815 WP_003401621.1.80853 WP_003401621.1.80918 WP_003401621.1.80967 WP_003401621.1.8097 WP_003401621.1.80988 WP_003401621.1.81013 WP_003401621.1.81059 WP_003401621.1.81066 WP_003401621.1.81075 WP_003401621.1.81091 WP_003401621.1.81136 WP_003401621.1.8114 WP_003401621.1.81189 WP_003401621.1.81192 WP_003401621.1.812 WP_003401621.1.81230 WP_003401621.1.81249 WP_003401621.1.81250 WP_003401621.1.81264 WP_003401621.1.8128 WP_003401621.1.81287 WP_003401621.1.81407 WP_003401621.1.8143 WP_003401621.1.81439 WP_003401621.1.81465 WP_003401621.1.81529 WP_003401621.1.81541 WP_003401621.1.81561 WP_003401621.1.81567 WP_003401621.1.81686 WP_003401621.1.81720 WP_003401621.1.81774 WP_003401621.1.81788 WP_003401621.1.81809 WP_003401621.1.81820 WP_003401621.1.81883 WP_003401621.1.81891 WP_003401621.1.82011 WP_003401621.1.82048 WP_003401621.1.82108 WP_003401621.1.82142 WP_003401621.1.8215 WP_003401621.1.8217 WP_003401621.1.82209 WP_003401621.1.82210 WP_003401621.1.82228 WP_003401621.1.82251 WP_003401621.1.82309 WP_003401621.1.82346 WP_003401621.1.82385 WP_003401621.1.82462 WP_003401621.1.82483 WP_003401621.1.82494 WP_003401621.1.82531 WP_003401621.1.82546 WP_003401621.1.82547 WP_003401621.1.82549 WP_003401621.1.82592 WP_003401621.1.82598 WP_003401621.1.82642 WP_003401621.1.82681 WP_003401621.1.8273 WP_003401621.1.82774 WP_003401621.1.82803 WP_003401621.1.82836 WP_003401621.1.82860 WP_003401621.1.82871 WP_003401621.1.82935 WP_003401621.1.82957 WP_003401621.1.82973 WP_003401621.1.82983 WP_003401621.1.83004 WP_003401621.1.83009 WP_003401621.1.83065 WP_003401621.1.83110 WP_003401621.1.83149 WP_003401621.1.83159 WP_003401621.1.83173 WP_003401621.1.83181 WP_003401621.1.83197 WP_003401621.1.83212 WP_003401621.1.83262 WP_003401621.1.83268 WP_003401621.1.83273 WP_003401621.1.83332 WP_003401621.1.83334 WP_003401621.1.83341 WP_003401621.1.83367 WP_003401621.1.83380 WP_003401621.1.83435 WP_003401621.1.83524 WP_003401621.1.83526 WP_003401621.1.8358 WP_003401621.1.83601 WP_003401621.1.83611 WP_003401621.1.83648 WP_003401621.1.83656 WP_003401621.1.83689 WP_003401621.1.83692 WP_003401621.1.83705 WP_003401621.1.83766 WP_003401621.1.83793 WP_003401621.1.83794 WP_003401621.1.83805 WP_003401621.1.83842 WP_003401621.1.83850 WP_003401621.1.83861 WP_003401621.1.83884 WP_003401621.1.83975 WP_003401621.1.84027 WP_003401621.1.8404 WP_003401621.1.8409 WP_003401621.1.8415 WP_003401621.1.84176 WP_003401621.1.84186 WP_003401621.1.84192 WP_003401621.1.84228 WP_003401621.1.84259 WP_003401621.1.84277 WP_003401621.1.84287 WP_003401621.1.84388 WP_003401621.1.84408 WP_003401621.1.84409 WP_003401621.1.84525 WP_003401621.1.84623 WP_003401621.1.84641 WP_003401621.1.84666 WP_003401621.1.84670 WP_003401621.1.84739 WP_003401621.1.84766 WP_003401621.1.84774 WP_003401621.1.84812 WP_003401621.1.84839 WP_003401621.1.84846 WP_003401621.1.84873 WP_003401621.1.84911 WP_003401621.1.84938 WP_003401621.1.84968 WP_003401621.1.84973 WP_003401621.1.84985 WP_003401621.1.85038 WP_003401621.1.85041 WP_003401621.1.8505 WP_003401621.1.85074 WP_003401621.1.8509 WP_003401621.1.8512 WP_003401621.1.85148 WP_003401621.1.8518 WP_003401621.1.8522 WP_003401621.1.85242 WP_003401621.1.85276 WP_003401621.1.85281 WP_003401621.1.85314 WP_003401621.1.85330 WP_003401621.1.85346 WP_003401621.1.8535 WP_003401621.1.85363 WP_003401621.1.85371 WP_003401621.1.85377 WP_003401621.1.85387 WP_003401621.1.85399 WP_003401621.1.85458 WP_003401621.1.85464 WP_003401621.1.85495 WP_003401621.1.85557 WP_003401621.1.85597 WP_003401621.1.85599 WP_003401621.1.85610 WP_003401621.1.8563 WP_003401621.1.85679 WP_003401621.1.85727 WP_003401621.1.85737 WP_003401621.1.85763 WP_003401621.1.85819 WP_003401621.1.85820 WP_003401621.1.85832 WP_003401621.1.85872 WP_003401621.1.85894 WP_003401621.1.85909 WP_003401621.1.86000 WP_003401621.1.86067 WP_003401621.1.86103 WP_003401621.1.86160 WP_003401621.1.86164 WP_003401621.1.86168 WP_003401621.1.86190 WP_003401621.1.86204 WP_003401621.1.86235 WP_003401621.1.86260 WP_003401621.1.86290 WP_003401621.1.863 WP_003401621.1.86327 WP_003401621.1.86334 WP_003401621.1.86337 WP_003401621.1.86377 WP_003401621.1.86425 WP_003401621.1.86459 WP_003401621.1.8649 WP_003401621.1.86568 WP_003401621.1.86575 WP_003401621.1.86584 WP_003401621.1.86605 WP_003401621.1.86626 WP_003401621.1.86648 WP_003401621.1.8666 WP_003401621.1.86684 WP_003401621.1.86705 WP_003401621.1.86801 WP_003401621.1.86814 WP_003401621.1.86825 WP_003401621.1.86834 WP_003401621.1.86855 WP_003401621.1.86877 WP_003401621.1.86883 WP_003401621.1.8689 WP_003401621.1.86933 WP_003401621.1.86950 WP_003401621.1.86962 WP_003401621.1.86979 WP_003401621.1.87001 WP_003401621.1.87031 WP_003401621.1.87117 WP_003401621.1.87162 WP_003401621.1.87178 WP_003401621.1.87191 WP_003401621.1.87201 WP_003401621.1.87209 WP_003401621.1.87240 WP_003401621.1.87266 WP_003401621.1.87273 WP_003401621.1.8733 WP_003401621.1.87345 WP_003401621.1.8737 WP_003401621.1.87404 WP_003401621.1.87406 WP_003401621.1.87444 WP_003401621.1.87446 WP_003401621.1.87489 WP_003401621.1.87496 WP_003401621.1.87582 WP_003401621.1.87588 WP_003401621.1.87617 WP_003401621.1.87619 WP_003401621.1.87620 WP_003401621.1.87643 WP_003401621.1.8765 WP_003401621.1.87650 WP_003401621.1.87665 WP_003401621.1.87676 WP_003401621.1.87677 WP_003401621.1.87684 WP_003401621.1.87692 WP_003401621.1.87707 WP_003401621.1.87784 WP_003401621.1.87796 WP_003401621.1.87817 WP_003401621.1.87835 WP_003401621.1.87837 WP_003401621.1.87911 WP_003401621.1.87924 WP_003401621.1.87951 WP_003401621.1.87956 WP_003401621.1.87991 WP_003401621.1.88 WP_003401621.1.88002 WP_003401621.1.88037 WP_003401621.1.88072 WP_003401621.1.88077 WP_003401621.1.88121 WP_003401621.1.88180 WP_003401621.1.88245 WP_003401621.1.88253 WP_003401621.1.88294 WP_003401621.1.88316 WP_003401621.1.88320 WP_003401621.1.88338 WP_003401621.1.88437 WP_003401621.1.88453 WP_003401621.1.88469 WP_003401621.1.88521 WP_003401621.1.88530 WP_003401621.1.88541 WP_003401621.1.88618 WP_003401621.1.8862 WP_003401621.1.88632 WP_003401621.1.88634 WP_003401621.1.88649 WP_003401621.1.88824 WP_003401621.1.88985 WP_003401621.1.8902 WP_003401621.1.89025 WP_003401621.1.89041 WP_003401621.1.89046 WP_003401621.1.89168 WP_003401621.1.89205 WP_003401621.1.8925 WP_003401621.1.89277 WP_003401621.1.89286 WP_003401621.1.89320 WP_003401621.1.8935 WP_003401621.1.89371 WP_003401621.1.89378 WP_003401621.1.89392 WP_003401621.1.89406 WP_003401621.1.89451 WP_003401621.1.89453 WP_003401621.1.89473 WP_003401621.1.89475 WP_003401621.1.89483 WP_003401621.1.895 WP_003401621.1.89513 WP_003401621.1.89517 WP_003401621.1.89522 WP_003401621.1.8954 WP_003401621.1.89543 WP_003401621.1.89567 WP_003401621.1.8957 WP_003401621.1.89572 WP_003401621.1.89589 WP_003401621.1.89607 WP_003401621.1.89625 WP_003401621.1.89648 WP_003401621.1.8967 WP_003401621.1.89670 WP_003401621.1.89676 WP_003401621.1.89739 WP_003401621.1.8977 WP_003401621.1.89802 WP_003401621.1.89808 WP_003401621.1.8982 WP_003401621.1.89844 WP_003401621.1.89903 WP_003401621.1.89909 WP_003401621.1.8992 WP_003401621.1.89926 WP_003401621.1.89971 WP_003401621.1.89987 WP_003401621.1.900 WP_003401621.1.9007 WP_003401621.1.90080 WP_003401621.1.90134 WP_003401621.1.90137 WP_003401621.1.90199 WP_003401621.1.90245 WP_003401621.1.90308 WP_003401621.1.90322 WP_003401621.1.90328 WP_003401621.1.90439 WP_003401621.1.90481 WP_003401621.1.90527 WP_003401621.1.90550 WP_003401621.1.90560 WP_003401621.1.90640 WP_003401621.1.90672 WP_003401621.1.90691 WP_003401621.1.90711 WP_003401621.1.9075 WP_003401621.1.90756 WP_003401621.1.90785 WP_003401621.1.90788 WP_003401621.1.90800 WP_003401621.1.90810 WP_003401621.1.90819 WP_003401621.1.9082 WP_003401621.1.90831 WP_003401621.1.90884 WP_003401621.1.90906 WP_003401621.1.90958 WP_003401621.1.90976 WP_003401621.1.90977 WP_003401621.1.90987 WP_003401621.1.9102 WP_003401621.1.91026 WP_003401621.1.91032 WP_003401621.1.91043 WP_003401621.1.91082 WP_003401621.1.91106 WP_003401621.1.91112 WP_003401621.1.91144 WP_003401621.1.91151 WP_003401621.1.91167 WP_003401621.1.91169 WP_003401621.1.91192 WP_003401621.1.91201 WP_003401621.1.91208 WP_003401621.1.91211 WP_003401621.1.91214 WP_003401621.1.91244 WP_003401621.1.91260 WP_003401621.1.91265 WP_003401621.1.9128 WP_003401621.1.91284 WP_003401621.1.91294 WP_003401621.1.91303 WP_003401621.1.91352 WP_003401621.1.91386 WP_003401621.1.91398 WP_003401621.1.91411 WP_003401621.1.91430 WP_003401621.1.91436 WP_003401621.1.91483 WP_003401621.1.91496 WP_003401621.1.91507 WP_003401621.1.91508 WP_003401621.1.91576 WP_003401621.1.91695 WP_003401621.1.91717 WP_003401621.1.91728 WP_003401621.1.91759 WP_003401621.1.91785 WP_003401621.1.91786 WP_003401621.1.91802 WP_003401621.1.91822 WP_003401621.1.91828 WP_003401621.1.9189 WP_003401621.1.9190 WP_003401621.1.91915 WP_003401621.1.91944 WP_003401621.1.91957 WP_003401621.1.91976 WP_003401621.1.91978 WP_003401621.1.92021 WP_003401621.1.92190 WP_003401621.1.92192 WP_003401621.1.92200 WP_003401621.1.92220 WP_003401621.1.92222 WP_003401621.1.92289 WP_003401621.1.9229 WP_003401621.1.92294 WP_003401621.1.92300 WP_003401621.1.92317 WP_003401621.1.92334 WP_003401621.1.92338 WP_003401621.1.92345 WP_003401621.1.92356 WP_003401621.1.92380 WP_003401621.1.92416 WP_003401621.1.92456 WP_003401621.1.92508 WP_003401621.1.9251 WP_003401621.1.92511 WP_003401621.1.92527 WP_003401621.1.92536 WP_003401621.1.92592 WP_003401621.1.92597 WP_003401621.1.92603 WP_003401621.1.92606 WP_003401621.1.92650 WP_003401621.1.92660 WP_003401621.1.92685 WP_003401621.1.92690 WP_003401621.1.92706 WP_003401621.1.92714 WP_003401621.1.92760 WP_003401621.1.92777 WP_003401621.1.92833 WP_003401621.1.92881 WP_003401621.1.92892 WP_003401621.1.92908 WP_003401621.1.9291 WP_003401621.1.92917 WP_003401621.1.93006 WP_003401621.1.93008 WP_003401621.1.93009 WP_003401621.1.9307 WP_003401621.1.93083 WP_003401621.1.93097 WP_003401621.1.93192 WP_003401621.1.93203 WP_003401621.1.93212 WP_003401621.1.93234 WP_003401621.1.93265 WP_003401621.1.93297 WP_003401621.1.93320 WP_003401621.1.93328 WP_003401621.1.93363 WP_003401621.1.93417 WP_003401621.1.93426 WP_003401621.1.9344 WP_003401621.1.93447 WP_003401621.1.93470 WP_003401621.1.93483 WP_003401621.1.93487 WP_003401621.1.93495 WP_003401621.1.93516 WP_003401621.1.93536 WP_003401621.1.93555 WP_003401621.1.93560 WP_003401621.1.9357 WP_003401621.1.93573 WP_003401621.1.93576 WP_003401621.1.93645 WP_003401621.1.93649 WP_003401621.1.93677 WP_003401621.1.93698 WP_003401621.1.93706 WP_003401621.1.9371 WP_003401621.1.93792 WP_003401621.1.93871 WP_003401621.1.9388 WP_003401621.1.93913 WP_003401621.1.93946 WP_003401621.1.93950 WP_003401621.1.93953 WP_003401621.1.93954 WP_003401621.1.93988 WP_003401621.1.9407 WP_003401621.1.94143 WP_003401621.1.94154 WP_003401621.1.94184 WP_003401621.1.94204 WP_003401621.1.94256 WP_003401621.1.94261 WP_003401621.1.94281 WP_003401621.1.94297 WP_003401621.1.9431 WP_003401621.1.94339 WP_003401621.1.94392 WP_003401621.1.94416 WP_003401621.1.94456 WP_003401621.1.94470 WP_003401621.1.94480 WP_003401621.1.94495 WP_003401621.1.94512 WP_003401621.1.94525 WP_003401621.1.94528 WP_003401621.1.94564 WP_003401621.1.946 WP_003401621.1.94602 WP_003401621.1.94623 WP_003401621.1.94629 WP_003401621.1.94714 WP_003401621.1.94730 WP_003401621.1.94736 WP_003401621.1.9478 WP_003401621.1.94834 WP_003401621.1.94852 WP_003401621.1.94872 WP_003401621.1.9488 WP_003401621.1.94902 WP_003401621.1.94916 WP_003401621.1.94998 WP_003401621.1.95007 WP_003401621.1.95068 WP_003401621.1.95081 WP_003401621.1.95082 WP_003401621.1.9509 WP_003401621.1.95096 WP_003401621.1.95112 WP_003401621.1.95138 WP_003401621.1.95188 WP_003401621.1.95234 WP_003401621.1.95245 WP_003401621.1.95257 WP_003401621.1.9531 WP_003401621.1.95335 WP_003401621.1.95344 WP_003401621.1.9535 WP_003401621.1.95370 WP_003401621.1.95392 WP_003401621.1.95416 WP_003401621.1.95417 WP_003401621.1.95491 WP_003401621.1.95497 WP_003401621.1.95508 WP_003401621.1.95509 WP_003401621.1.95529 WP_003401621.1.95556 WP_003401621.1.95557 WP_003401621.1.95565 WP_003401621.1.95578 WP_003401621.1.95580 WP_003401621.1.95585 WP_003401621.1.95643 WP_003401621.1.95679 WP_003401621.1.95685 WP_003401621.1.957 WP_003401621.1.95724 WP_003401621.1.95730 WP_003401621.1.95735 WP_003401621.1.95772 WP_003401621.1.95797 WP_003401621.1.95839 WP_003401621.1.9585 WP_003401621.1.95902 WP_003401621.1.95908 WP_003401621.1.95924 WP_003401621.1.95926 WP_003401621.1.95953 WP_003401621.1.95958 WP_003401621.1.95964 WP_003401621.1.96006 WP_003401621.1.96036 WP_003401621.1.96065 WP_003401621.1.96098 WP_003401621.1.96146 WP_003401621.1.96166 WP_003401621.1.96171 WP_003401621.1.96182 WP_003401621.1.96204 WP_003401621.1.96235 WP_003401621.1.96242 WP_003401621.1.96245 WP_003401621.1.96254 WP_003401621.1.96259 WP_003401621.1.96313 WP_003401621.1.96318 WP_003401621.1.96345 WP_003401621.1.96360 WP_003401621.1.96373 WP_003401621.1.96456 WP_003401621.1.96560 WP_003401621.1.96575 WP_003401621.1.96576 WP_003401621.1.96621 WP_003401621.1.9667 WP_003401621.1.96681 WP_003401621.1.96726 WP_003401621.1.96733 WP_003401621.1.96742 WP_003401621.1.96754 WP_003401621.1.9678 WP_003401621.1.97008 WP_003401621.1.97009 WP_003401621.1.97084 WP_003401621.1.97087 WP_003401621.1.97094 WP_003401621.1.97099 WP_003401621.1.97113 WP_003401621.1.97122 WP_003401621.1.97127 WP_003401621.1.97136 WP_003401621.1.97223 WP_003401621.1.97237 WP_003401621.1.97242 WP_003401621.1.97270 WP_003401621.1.97283 WP_003401621.1.97296 WP_003401621.1.97321 WP_003401621.1.97325 WP_003401621.1.97330 WP_003401621.1.97376 WP_003401621.1.97380 WP_003401621.1.9739 WP_003401621.1.97462 WP_003401621.1.97517 WP_003401621.1.97519 WP_003401621.1.97535 WP_003401621.1.97545 WP_003401621.1.97546 WP_003401621.1.97591 WP_003401621.1.97596 WP_003401621.1.97609 WP_003401621.1.97618 WP_003401621.1.9763 WP_003401621.1.97669 WP_003401621.1.97673 WP_003401621.1.97700 WP_003401621.1.97701 WP_003401621.1.97740 WP_003401621.1.97754 WP_003401621.1.97888 WP_003401621.1.9795 WP_003401621.1.97951 WP_003401621.1.97958 WP_003401621.1.97966 WP_003401621.1.97977 WP_003401621.1.98018 WP_003401621.1.98052 WP_003401621.1.98071 WP_003401621.1.98072 WP_003401621.1.98113 WP_003401621.1.98114 WP_003401621.1.98181 WP_003401621.1.98188 WP_003401621.1.98189 WP_003401621.1.98213 WP_003401621.1.98291 WP_003401621.1.98335 WP_003401621.1.98412 WP_003401621.1.98441 WP_003401621.1.98443 WP_003401621.1.98462 WP_003401621.1.9848 WP_003401621.1.98482 WP_003401621.1.98486 WP_003401621.1.98488 WP_003401621.1.98503 WP_003401621.1.98516 WP_003401621.1.98524 WP_003401621.1.98536 WP_003401621.1.98541 WP_003401621.1.98594 WP_003401621.1.98599 WP_003401621.1.98645 WP_003401621.1.98656 WP_003401621.1.98674 WP_003401621.1.98697 WP_003401621.1.98701 WP_003401621.1.98749 WP_003401621.1.98765 WP_003401621.1.98770 WP_003401621.1.98777 WP_003401621.1.98778 WP_003401621.1.98802 WP_003401621.1.98838 WP_003401621.1.98850 WP_003401621.1.98935 WP_003401621.1.98948 WP_003401621.1.98984 WP_003401621.1.99023 WP_003401621.1.99030 WP_003401621.1.99037 WP_003401621.1.99055 WP_003401621.1.99062 WP_003401621.1.99086 WP_003401621.1.99115 WP_003401621.1.99117 WP_003401621.1.99161 WP_003401621.1.99176 WP_003401621.1.99205 WP_003401621.1.99216 WP_003401621.1.99222 WP_003401621.1.99269 WP_003401621.1.99294 WP_003401621.1.99315 WP_003401621.1.99322 WP_003401621.1.99328 WP_003401621.1.99365 WP_003401621.1.99379 WP_003401621.1.99396 WP_003401621.1.99402 WP_003401621.1.99419 WP_003401621.1.99438 WP_003401621.1.99460 WP_003401621.1.99468 WP_003401621.1.99473 WP_003401621.1.99513 WP_003401621.1.99529 WP_003401621.1.99548 WP_003401621.1.99572 WP_003401621.1.99575 WP_003401621.1.99609 WP_003401621.1.99617 WP_003401621.1.99635 WP_003401621.1.99650 WP_003401621.1.99672 WP_003401621.1.99711 WP_003401621.1.99716 WP_003401621.1.99740 WP_003401621.1.99745 WP_003401621.1.99749 WP_003401621.1.9976 WP_003401621.1.99798 WP_003401621.1.99832 WP_003401621.1.99847 WP_003401621.1.99852 WP_003401621.1.99897 WP_003401621.1.99915 WP_003401621.1.9993 WP_003401621.1.99982 gi|449062311|ref|YP_007429394.1| gi|392385034|ref|YP_005306663.1| gi|525673158|ref|YP_008224411.1| gi|392430733|ref|YP_006471777.1| gi|386003381|ref|YP_005921660.1| gi|148821511|ref|YP_001286265.1| gi|433640444|ref|YP_007286203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]