SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 233413.Mb1120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  233413.Mb1120
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.72e-47
Family Xylanase/endoglucanase 11/12 0.0000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 233413.Mb1120
Sequence length 151
Comment (Mycobacterium bovis)
Sequence
MGTNLPTEVGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQQEIMIWFNHQGS
IQPVGSPVGNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPIT
DSWYLTSIRAGLEPWSDGVGLGVDSFSAKVN
Download sequence
Identical sequences A0A045J6V8 A0A083WC56 A0A089QND5 A0A0H3L7Q9 A0A0H3M369 A0A0K2HUY6 A0A109SLU9 A0A120J0F8 A0A197J235 A0A1R3XXB8 A0A1S1BHQ6 A5U1D7 F8M5A2 L7N5B2 O53438 R4M4K7
gi|392385793|ref|YP_005307422.1| gi|15840528|ref|NP_335565.1| gi|471336986|ref|YP_007609699.1| gi|339631156|ref|YP_004722798.1| gi|494699495|ref|YP_007964977.1| gi|449063149|ref|YP_007430232.1| gi|15608230|ref|NP_215606.1| 233413.Mb1120 336982.TBFG_11111 410289.BCG_1150 419947.MRA_1101 478434.TBMG_02895 561275.JTY_1123 83331.MT1122 83332.Rv1090 gi|148822302|ref|YP_001287056.1| gi|375297111|ref|YP_005101378.1| WP_003900273.1.100000 WP_003900273.1.100021 WP_003900273.1.100069 WP_003900273.1.100087 WP_003900273.1.10015 WP_003900273.1.10022 WP_003900273.1.100260 WP_003900273.1.100270 WP_003900273.1.100279 WP_003900273.1.100286 WP_003900273.1.100309 WP_003900273.1.100318 WP_003900273.1.100337 WP_003900273.1.100338 WP_003900273.1.10037 WP_003900273.1.100383 WP_003900273.1.100395 WP_003900273.1.100396 WP_003900273.1.1004 WP_003900273.1.100401 WP_003900273.1.100459 WP_003900273.1.100552 WP_003900273.1.100581 WP_003900273.1.100600 WP_003900273.1.100625 WP_003900273.1.10064 WP_003900273.1.100666 WP_003900273.1.100671 WP_003900273.1.100677 WP_003900273.1.100682 WP_003900273.1.100757 WP_003900273.1.100772 WP_003900273.1.100812 WP_003900273.1.100845 WP_003900273.1.10088 WP_003900273.1.10090 WP_003900273.1.100910 WP_003900273.1.100918 WP_003900273.1.100935 WP_003900273.1.101 WP_003900273.1.101025 WP_003900273.1.101028 WP_003900273.1.10104 WP_003900273.1.101048 WP_003900273.1.101054 WP_003900273.1.101075 WP_003900273.1.101143 WP_003900273.1.101146 WP_003900273.1.10117 WP_003900273.1.10125 WP_003900273.1.101290 WP_003900273.1.101323 WP_003900273.1.101324 WP_003900273.1.101367 WP_003900273.1.101398 WP_003900273.1.101403 WP_003900273.1.101421 WP_003900273.1.10145 WP_003900273.1.101452 WP_003900273.1.101456 WP_003900273.1.101481 WP_003900273.1.101493 WP_003900273.1.101496 WP_003900273.1.101525 WP_003900273.1.101533 WP_003900273.1.101535 WP_003900273.1.101558 WP_003900273.1.10156 WP_003900273.1.101576 WP_003900273.1.101604 WP_003900273.1.101622 WP_003900273.1.101644 WP_003900273.1.101659 WP_003900273.1.101671 WP_003900273.1.10170 WP_003900273.1.101713 WP_003900273.1.101722 WP_003900273.1.101733 WP_003900273.1.101753 WP_003900273.1.101773 WP_003900273.1.101795 WP_003900273.1.101798 WP_003900273.1.101826 WP_003900273.1.101836 WP_003900273.1.101858 WP_003900273.1.101859 WP_003900273.1.101862 WP_003900273.1.101888 WP_003900273.1.101894 WP_003900273.1.1019 WP_003900273.1.101923 WP_003900273.1.101925 WP_003900273.1.10193 WP_003900273.1.101996 WP_003900273.1.102008 WP_003900273.1.102055 WP_003900273.1.102099 WP_003900273.1.1021 WP_003900273.1.10211 WP_003900273.1.102143 WP_003900273.1.10216 WP_003900273.1.10224 WP_003900273.1.10253 WP_003900273.1.10272 WP_003900273.1.10277 WP_003900273.1.1033 WP_003900273.1.10362 WP_003900273.1.10366 WP_003900273.1.10376 WP_003900273.1.10410 WP_003900273.1.10414 WP_003900273.1.10421 WP_003900273.1.1044 WP_003900273.1.10440 WP_003900273.1.10445 WP_003900273.1.10471 WP_003900273.1.10472 WP_003900273.1.10489 WP_003900273.1.10518 WP_003900273.1.10523 WP_003900273.1.10594 WP_003900273.1.10603 WP_003900273.1.10606 WP_003900273.1.10615 WP_003900273.1.10623 WP_003900273.1.10635 WP_003900273.1.10648 WP_003900273.1.10662 WP_003900273.1.10709 WP_003900273.1.10735 WP_003900273.1.10740 WP_003900273.1.1078 WP_003900273.1.10791 WP_003900273.1.10799 WP_003900273.1.10848 WP_003900273.1.10863 WP_003900273.1.10912 WP_003900273.1.10916 WP_003900273.1.10923 WP_003900273.1.10927 WP_003900273.1.10958 WP_003900273.1.10962 WP_003900273.1.10981 WP_003900273.1.10993 WP_003900273.1.11040 WP_003900273.1.11061 WP_003900273.1.11070 WP_003900273.1.11141 WP_003900273.1.11171 WP_003900273.1.11176 WP_003900273.1.11236 WP_003900273.1.11329 WP_003900273.1.1133 WP_003900273.1.11342 WP_003900273.1.11376 WP_003900273.1.11402 WP_003900273.1.11481 WP_003900273.1.11487 WP_003900273.1.11489 WP_003900273.1.11491 WP_003900273.1.11514 WP_003900273.1.11587 WP_003900273.1.11589 WP_003900273.1.11596 WP_003900273.1.11604 WP_003900273.1.11610 WP_003900273.1.11697 WP_003900273.1.11707 WP_003900273.1.11752 WP_003900273.1.11758 WP_003900273.1.11775 WP_003900273.1.11804 WP_003900273.1.11822 WP_003900273.1.11826 WP_003900273.1.11856 WP_003900273.1.11906 WP_003900273.1.11939 WP_003900273.1.11960 WP_003900273.1.11961 WP_003900273.1.11972 WP_003900273.1.11984 WP_003900273.1.120 WP_003900273.1.12001 WP_003900273.1.12100 WP_003900273.1.12130 WP_003900273.1.12133 WP_003900273.1.12161 WP_003900273.1.12165 WP_003900273.1.12184 WP_003900273.1.12187 WP_003900273.1.12216 WP_003900273.1.12265 WP_003900273.1.12275 WP_003900273.1.12293 WP_003900273.1.123 WP_003900273.1.12314 WP_003900273.1.12327 WP_003900273.1.12338 WP_003900273.1.12371 WP_003900273.1.12372 WP_003900273.1.12389 WP_003900273.1.12406 WP_003900273.1.1241 WP_003900273.1.12421 WP_003900273.1.12424 WP_003900273.1.12446 WP_003900273.1.12464 WP_003900273.1.12479 WP_003900273.1.12519 WP_003900273.1.12523 WP_003900273.1.12526 WP_003900273.1.12550 WP_003900273.1.12551 WP_003900273.1.12563 WP_003900273.1.12611 WP_003900273.1.12669 WP_003900273.1.1267 WP_003900273.1.12672 WP_003900273.1.12710 WP_003900273.1.12768 WP_003900273.1.12794 WP_003900273.1.12801 WP_003900273.1.12821 WP_003900273.1.12841 WP_003900273.1.12854 WP_003900273.1.12871 WP_003900273.1.12901 WP_003900273.1.12941 WP_003900273.1.12972 WP_003900273.1.13028 WP_003900273.1.13087 WP_003900273.1.13163 WP_003900273.1.13183 WP_003900273.1.13249 WP_003900273.1.13282 WP_003900273.1.13296 WP_003900273.1.13298 WP_003900273.1.13302 WP_003900273.1.13312 WP_003900273.1.13313 WP_003900273.1.13321 WP_003900273.1.13345 WP_003900273.1.13358 WP_003900273.1.13370 WP_003900273.1.13375 WP_003900273.1.1338 WP_003900273.1.13420 WP_003900273.1.13433 WP_003900273.1.13435 WP_003900273.1.13438 WP_003900273.1.13466 WP_003900273.1.13526 WP_003900273.1.13551 WP_003900273.1.13561 WP_003900273.1.13579 WP_003900273.1.13687 WP_003900273.1.13719 WP_003900273.1.13763 WP_003900273.1.1377 WP_003900273.1.13774 WP_003900273.1.13786 WP_003900273.1.13793 WP_003900273.1.13794 WP_003900273.1.13817 WP_003900273.1.13899 WP_003900273.1.13909 WP_003900273.1.13910 WP_003900273.1.13952 WP_003900273.1.13953 WP_003900273.1.13962 WP_003900273.1.1398 WP_003900273.1.14027 WP_003900273.1.14115 WP_003900273.1.1415 WP_003900273.1.14152 WP_003900273.1.14162 WP_003900273.1.14175 WP_003900273.1.14194 WP_003900273.1.14195 WP_003900273.1.14238 WP_003900273.1.14273 WP_003900273.1.14306 WP_003900273.1.14307 WP_003900273.1.14310 WP_003900273.1.14341 WP_003900273.1.14382 WP_003900273.1.14428 WP_003900273.1.14441 WP_003900273.1.14469 WP_003900273.1.14504 WP_003900273.1.1452 WP_003900273.1.14527 WP_003900273.1.14544 WP_003900273.1.14551 WP_003900273.1.14561 WP_003900273.1.14573 WP_003900273.1.1462 WP_003900273.1.14658 WP_003900273.1.14668 WP_003900273.1.14675 WP_003900273.1.14694 WP_003900273.1.14695 WP_003900273.1.14709 WP_003900273.1.14766 WP_003900273.1.14783 WP_003900273.1.14865 WP_003900273.1.14872 WP_003900273.1.14905 WP_003900273.1.14926 WP_003900273.1.14955 WP_003900273.1.15003 WP_003900273.1.15009 WP_003900273.1.15040 WP_003900273.1.15065 WP_003900273.1.15089 WP_003900273.1.1509 WP_003900273.1.15126 WP_003900273.1.15131 WP_003900273.1.15172 WP_003900273.1.15174 WP_003900273.1.15187 WP_003900273.1.15196 WP_003900273.1.15217 WP_003900273.1.1523 WP_003900273.1.15240 WP_003900273.1.15253 WP_003900273.1.15267 WP_003900273.1.1527 WP_003900273.1.15292 WP_003900273.1.15302 WP_003900273.1.15322 WP_003900273.1.15345 WP_003900273.1.15372 WP_003900273.1.15386 WP_003900273.1.15442 WP_003900273.1.15447 WP_003900273.1.15449 WP_003900273.1.15477 WP_003900273.1.15511 WP_003900273.1.15558 WP_003900273.1.15559 WP_003900273.1.15566 WP_003900273.1.15599 WP_003900273.1.1560 WP_003900273.1.1563 WP_003900273.1.15633 WP_003900273.1.15643 WP_003900273.1.15755 WP_003900273.1.15763 WP_003900273.1.15774 WP_003900273.1.1578 WP_003900273.1.15780 WP_003900273.1.15827 WP_003900273.1.15848 WP_003900273.1.15870 WP_003900273.1.15877 WP_003900273.1.15893 WP_003900273.1.15896 WP_003900273.1.15926 WP_003900273.1.15933 WP_003900273.1.15958 WP_003900273.1.15973 WP_003900273.1.16009 WP_003900273.1.16043 WP_003900273.1.16055 WP_003900273.1.16066 WP_003900273.1.16077 WP_003900273.1.16108 WP_003900273.1.16110 WP_003900273.1.16130 WP_003900273.1.16136 WP_003900273.1.16139 WP_003900273.1.16141 WP_003900273.1.16143 WP_003900273.1.1630 WP_003900273.1.16318 WP_003900273.1.1632 WP_003900273.1.16327 WP_003900273.1.16334 WP_003900273.1.16374 WP_003900273.1.16384 WP_003900273.1.16386 WP_003900273.1.1642 WP_003900273.1.16421 WP_003900273.1.16424 WP_003900273.1.16426 WP_003900273.1.16431 WP_003900273.1.16438 WP_003900273.1.1644 WP_003900273.1.16442 WP_003900273.1.16448 WP_003900273.1.16451 WP_003900273.1.16476 WP_003900273.1.16494 WP_003900273.1.1652 WP_003900273.1.16609 WP_003900273.1.16620 WP_003900273.1.16622 WP_003900273.1.1669 WP_003900273.1.16707 WP_003900273.1.16724 WP_003900273.1.16731 WP_003900273.1.1683 WP_003900273.1.16937 WP_003900273.1.16940 WP_003900273.1.16959 WP_003900273.1.16968 WP_003900273.1.1697 WP_003900273.1.16973 WP_003900273.1.16977 WP_003900273.1.17006 WP_003900273.1.17010 WP_003900273.1.17039 WP_003900273.1.17041 WP_003900273.1.17057 WP_003900273.1.17062 WP_003900273.1.1707 WP_003900273.1.17130 WP_003900273.1.17138 WP_003900273.1.17167 WP_003900273.1.17224 WP_003900273.1.17251 WP_003900273.1.17304 WP_003900273.1.17314 WP_003900273.1.17345 WP_003900273.1.17381 WP_003900273.1.17391 WP_003900273.1.17412 WP_003900273.1.1743 WP_003900273.1.17440 WP_003900273.1.17466 WP_003900273.1.17477 WP_003900273.1.17483 WP_003900273.1.17505 WP_003900273.1.17527 WP_003900273.1.17535 WP_003900273.1.17553 WP_003900273.1.17635 WP_003900273.1.17679 WP_003900273.1.1768 WP_003900273.1.17687 WP_003900273.1.17713 WP_003900273.1.17722 WP_003900273.1.17746 WP_003900273.1.17788 WP_003900273.1.17803 WP_003900273.1.17816 WP_003900273.1.17821 WP_003900273.1.17868 WP_003900273.1.17923 WP_003900273.1.1795 WP_003900273.1.17955 WP_003900273.1.17973 WP_003900273.1.18009 WP_003900273.1.18013 WP_003900273.1.18033 WP_003900273.1.18057 WP_003900273.1.18065 WP_003900273.1.18070 WP_003900273.1.18120 WP_003900273.1.18126 WP_003900273.1.1817 WP_003900273.1.18170 WP_003900273.1.18240 WP_003900273.1.18257 WP_003900273.1.18297 WP_003900273.1.18306 WP_003900273.1.18364 WP_003900273.1.18399 WP_003900273.1.18411 WP_003900273.1.18444 WP_003900273.1.18448 WP_003900273.1.18467 WP_003900273.1.18582 WP_003900273.1.18587 WP_003900273.1.186 WP_003900273.1.18639 WP_003900273.1.18646 WP_003900273.1.1868 WP_003900273.1.18694 WP_003900273.1.18710 WP_003900273.1.18751 WP_003900273.1.18793 WP_003900273.1.18827 WP_003900273.1.18838 WP_003900273.1.18945 WP_003900273.1.1898 WP_003900273.1.19005 WP_003900273.1.19063 WP_003900273.1.19066 WP_003900273.1.19071 WP_003900273.1.19085 WP_003900273.1.19094 WP_003900273.1.19144 WP_003900273.1.19159 WP_003900273.1.19193 WP_003900273.1.19231 WP_003900273.1.19264 WP_003900273.1.19295 WP_003900273.1.19307 WP_003900273.1.19326 WP_003900273.1.1933 WP_003900273.1.19364 WP_003900273.1.19382 WP_003900273.1.19426 WP_003900273.1.19429 WP_003900273.1.19464 WP_003900273.1.19512 WP_003900273.1.19562 WP_003900273.1.19564 WP_003900273.1.19568 WP_003900273.1.19572 WP_003900273.1.19595 WP_003900273.1.19600 WP_003900273.1.19630 WP_003900273.1.1967 WP_003900273.1.19694 WP_003900273.1.19742 WP_003900273.1.19820 WP_003900273.1.19868 WP_003900273.1.19890 WP_003900273.1.19900 WP_003900273.1.19946 WP_003900273.1.19949 WP_003900273.1.19960 WP_003900273.1.20007 WP_003900273.1.20016 WP_003900273.1.20028 WP_003900273.1.2003 WP_003900273.1.20037 WP_003900273.1.20039 WP_003900273.1.20082 WP_003900273.1.20116 WP_003900273.1.20140 WP_003900273.1.20141 WP_003900273.1.20158 WP_003900273.1.20239 WP_003900273.1.20243 WP_003900273.1.20259 WP_003900273.1.20262 WP_003900273.1.20268 WP_003900273.1.20272 WP_003900273.1.20273 WP_003900273.1.20280 WP_003900273.1.20294 WP_003900273.1.20300 WP_003900273.1.20322 WP_003900273.1.2037 WP_003900273.1.20372 WP_003900273.1.20381 WP_003900273.1.204 WP_003900273.1.20427 WP_003900273.1.20432 WP_003900273.1.20457 WP_003900273.1.20460 WP_003900273.1.20542 WP_003900273.1.20608 WP_003900273.1.20624 WP_003900273.1.20628 WP_003900273.1.2066 WP_003900273.1.20722 WP_003900273.1.2086 WP_003900273.1.20868 WP_003900273.1.20897 WP_003900273.1.20898 WP_003900273.1.2090 WP_003900273.1.20911 WP_003900273.1.20916 WP_003900273.1.20921 WP_003900273.1.20926 WP_003900273.1.20927 WP_003900273.1.20970 WP_003900273.1.2104 WP_003900273.1.21070 WP_003900273.1.21135 WP_003900273.1.21173 WP_003900273.1.21187 WP_003900273.1.2120 WP_003900273.1.21218 WP_003900273.1.2123 WP_003900273.1.21234 WP_003900273.1.2126 WP_003900273.1.21292 WP_003900273.1.21307 WP_003900273.1.21311 WP_003900273.1.21321 WP_003900273.1.21365 WP_003900273.1.2137 WP_003900273.1.21392 WP_003900273.1.21397 WP_003900273.1.21415 WP_003900273.1.21418 WP_003900273.1.21430 WP_003900273.1.21434 WP_003900273.1.21444 WP_003900273.1.21509 WP_003900273.1.21560 WP_003900273.1.21591 WP_003900273.1.21594 WP_003900273.1.21615 WP_003900273.1.21655 WP_003900273.1.21658 WP_003900273.1.2168 WP_003900273.1.2174 WP_003900273.1.21741 WP_003900273.1.21742 WP_003900273.1.21786 WP_003900273.1.21795 WP_003900273.1.218 WP_003900273.1.21829 WP_003900273.1.21840 WP_003900273.1.21843 WP_003900273.1.21872 WP_003900273.1.21873 WP_003900273.1.2188 WP_003900273.1.21882 WP_003900273.1.21906 WP_003900273.1.21912 WP_003900273.1.21941 WP_003900273.1.21960 WP_003900273.1.21971 WP_003900273.1.22025 WP_003900273.1.22036 WP_003900273.1.22092 WP_003900273.1.22127 WP_003900273.1.22140 WP_003900273.1.22255 WP_003900273.1.22305 WP_003900273.1.22356 WP_003900273.1.2238 WP_003900273.1.22437 WP_003900273.1.22445 WP_003900273.1.22490 WP_003900273.1.22511 WP_003900273.1.22524 WP_003900273.1.2253 WP_003900273.1.22585 WP_003900273.1.22589 WP_003900273.1.22606 WP_003900273.1.22608 WP_003900273.1.22618 WP_003900273.1.2262 WP_003900273.1.22629 WP_003900273.1.22647 WP_003900273.1.22664 WP_003900273.1.22674 WP_003900273.1.22680 WP_003900273.1.22725 WP_003900273.1.22728 WP_003900273.1.22733 WP_003900273.1.22737 WP_003900273.1.2275 WP_003900273.1.22797 WP_003900273.1.22800 WP_003900273.1.22829 WP_003900273.1.22840 WP_003900273.1.22844 WP_003900273.1.22963 WP_003900273.1.22997 WP_003900273.1.22999 WP_003900273.1.23015 WP_003900273.1.231 WP_003900273.1.23101 WP_003900273.1.23140 WP_003900273.1.23153 WP_003900273.1.23171 WP_003900273.1.23199 WP_003900273.1.2320 WP_003900273.1.23216 WP_003900273.1.23233 WP_003900273.1.23261 WP_003900273.1.23272 WP_003900273.1.23289 WP_003900273.1.2329 WP_003900273.1.23308 WP_003900273.1.23316 WP_003900273.1.23321 WP_003900273.1.2339 WP_003900273.1.23406 WP_003900273.1.23438 WP_003900273.1.23445 WP_003900273.1.23447 WP_003900273.1.23452 WP_003900273.1.23461 WP_003900273.1.23497 WP_003900273.1.23506 WP_003900273.1.23530 WP_003900273.1.23539 WP_003900273.1.23546 WP_003900273.1.23573 WP_003900273.1.23588 WP_003900273.1.23628 WP_003900273.1.23683 WP_003900273.1.23692 WP_003900273.1.23699 WP_003900273.1.23803 WP_003900273.1.23832 WP_003900273.1.2384 WP_003900273.1.23863 WP_003900273.1.23894 WP_003900273.1.23993 WP_003900273.1.24007 WP_003900273.1.24008 WP_003900273.1.24046 WP_003900273.1.24057 WP_003900273.1.24062 WP_003900273.1.24113 WP_003900273.1.24119 WP_003900273.1.24128 WP_003900273.1.24140 WP_003900273.1.24202 WP_003900273.1.24244 WP_003900273.1.24261 WP_003900273.1.24284 WP_003900273.1.24396 WP_003900273.1.24414 WP_003900273.1.24423 WP_003900273.1.2443 WP_003900273.1.24446 WP_003900273.1.24500 WP_003900273.1.24507 WP_003900273.1.24509 WP_003900273.1.24553 WP_003900273.1.24599 WP_003900273.1.24629 WP_003900273.1.24638 WP_003900273.1.24648 WP_003900273.1.2466 WP_003900273.1.24767 WP_003900273.1.24824 WP_003900273.1.24831 WP_003900273.1.24840 WP_003900273.1.24848 WP_003900273.1.24857 WP_003900273.1.2487 WP_003900273.1.24893 WP_003900273.1.24907 WP_003900273.1.24958 WP_003900273.1.24985 WP_003900273.1.2499 WP_003900273.1.25004 WP_003900273.1.2505 WP_003900273.1.2507 WP_003900273.1.25096 WP_003900273.1.25103 WP_003900273.1.25129 WP_003900273.1.25171 WP_003900273.1.25247 WP_003900273.1.25252 WP_003900273.1.25278 WP_003900273.1.25283 WP_003900273.1.25313 WP_003900273.1.25338 WP_003900273.1.25342 WP_003900273.1.25343 WP_003900273.1.25406 WP_003900273.1.25435 WP_003900273.1.25437 WP_003900273.1.25445 WP_003900273.1.25473 WP_003900273.1.25504 WP_003900273.1.25513 WP_003900273.1.25542 WP_003900273.1.25579 WP_003900273.1.25594 WP_003900273.1.25606 WP_003900273.1.25645 WP_003900273.1.25674 WP_003900273.1.25693 WP_003900273.1.25699 WP_003900273.1.25727 WP_003900273.1.25736 WP_003900273.1.25756 WP_003900273.1.25759 WP_003900273.1.2580 WP_003900273.1.25813 WP_003900273.1.25853 WP_003900273.1.25854 WP_003900273.1.25874 WP_003900273.1.25885 WP_003900273.1.25892 WP_003900273.1.25906 WP_003900273.1.25914 WP_003900273.1.25916 WP_003900273.1.25954 WP_003900273.1.25965 WP_003900273.1.25972 WP_003900273.1.26017 WP_003900273.1.26032 WP_003900273.1.26072 WP_003900273.1.26089 WP_003900273.1.26097 WP_003900273.1.26098 WP_003900273.1.26108 WP_003900273.1.26109 WP_003900273.1.26126 WP_003900273.1.2614 WP_003900273.1.26168 WP_003900273.1.26182 WP_003900273.1.26190 WP_003900273.1.2620 WP_003900273.1.26234 WP_003900273.1.26243 WP_003900273.1.26265 WP_003900273.1.26267 WP_003900273.1.26310 WP_003900273.1.26349 WP_003900273.1.26366 WP_003900273.1.26374 WP_003900273.1.26407 WP_003900273.1.26412 WP_003900273.1.26454 WP_003900273.1.26464 WP_003900273.1.2653 WP_003900273.1.26560 WP_003900273.1.2659 WP_003900273.1.26603 WP_003900273.1.26629 WP_003900273.1.26651 WP_003900273.1.26707 WP_003900273.1.26710 WP_003900273.1.26719 WP_003900273.1.26738 WP_003900273.1.26745 WP_003900273.1.26756 WP_003900273.1.2676 WP_003900273.1.2677 WP_003900273.1.26780 WP_003900273.1.26798 WP_003900273.1.26854 WP_003900273.1.26868 WP_003900273.1.26876 WP_003900273.1.26888 WP_003900273.1.26914 WP_003900273.1.26959 WP_003900273.1.26969 WP_003900273.1.26984 WP_003900273.1.27004 WP_003900273.1.27017 WP_003900273.1.27045 WP_003900273.1.27075 WP_003900273.1.27128 WP_003900273.1.27130 WP_003900273.1.27139 WP_003900273.1.27152 WP_003900273.1.27162 WP_003900273.1.27164 WP_003900273.1.27193 WP_003900273.1.27235 WP_003900273.1.27254 WP_003900273.1.27278 WP_003900273.1.27352 WP_003900273.1.27369 WP_003900273.1.27391 WP_003900273.1.27398 WP_003900273.1.27402 WP_003900273.1.27410 WP_003900273.1.27411 WP_003900273.1.27449 WP_003900273.1.27463 WP_003900273.1.2749 WP_003900273.1.27492 WP_003900273.1.27528 WP_003900273.1.27541 WP_003900273.1.27582 WP_003900273.1.27596 WP_003900273.1.27607 WP_003900273.1.2766 WP_003900273.1.27724 WP_003900273.1.27730 WP_003900273.1.27736 WP_003900273.1.27743 WP_003900273.1.27771 WP_003900273.1.27779 WP_003900273.1.27803 WP_003900273.1.27819 WP_003900273.1.27835 WP_003900273.1.27915 WP_003900273.1.27935 WP_003900273.1.27962 WP_003900273.1.28053 WP_003900273.1.28106 WP_003900273.1.28142 WP_003900273.1.2816 WP_003900273.1.28161 WP_003900273.1.28192 WP_003900273.1.28202 WP_003900273.1.28241 WP_003900273.1.28242 WP_003900273.1.28251 WP_003900273.1.28255 WP_003900273.1.28269 WP_003900273.1.28276 WP_003900273.1.28293 WP_003900273.1.28331 WP_003900273.1.28378 WP_003900273.1.2842 WP_003900273.1.28448 WP_003900273.1.2847 WP_003900273.1.28471 WP_003900273.1.28473 WP_003900273.1.28561 WP_003900273.1.28610 WP_003900273.1.28634 WP_003900273.1.28642 WP_003900273.1.28671 WP_003900273.1.28682 WP_003900273.1.28703 WP_003900273.1.28739 WP_003900273.1.28758 WP_003900273.1.28781 WP_003900273.1.28850 WP_003900273.1.28914 WP_003900273.1.28935 WP_003900273.1.28936 WP_003900273.1.28939 WP_003900273.1.28943 WP_003900273.1.28952 WP_003900273.1.28975 WP_003900273.1.2899 WP_003900273.1.28993 WP_003900273.1.29000 WP_003900273.1.2901 WP_003900273.1.29028 WP_003900273.1.29078 WP_003900273.1.29102 WP_003900273.1.29217 WP_003900273.1.29223 WP_003900273.1.29234 WP_003900273.1.29264 WP_003900273.1.29275 WP_003900273.1.29339 WP_003900273.1.29348 WP_003900273.1.29367 WP_003900273.1.2938 WP_003900273.1.29399 WP_003900273.1.29426 WP_003900273.1.29449 WP_003900273.1.29450 WP_003900273.1.29452 WP_003900273.1.2949 WP_003900273.1.29510 WP_003900273.1.29515 WP_003900273.1.2953 WP_003900273.1.29559 WP_003900273.1.2959 WP_003900273.1.29592 WP_003900273.1.29599 WP_003900273.1.29611 WP_003900273.1.29632 WP_003900273.1.29649 WP_003900273.1.2965 WP_003900273.1.29659 WP_003900273.1.2969 WP_003900273.1.29696 WP_003900273.1.29698 WP_003900273.1.29718 WP_003900273.1.29742 WP_003900273.1.29745 WP_003900273.1.29769 WP_003900273.1.29825 WP_003900273.1.29847 WP_003900273.1.29883 WP_003900273.1.29890 WP_003900273.1.299 WP_003900273.1.29960 WP_003900273.1.30014 WP_003900273.1.3004 WP_003900273.1.30040 WP_003900273.1.30043 WP_003900273.1.30074 WP_003900273.1.30097 WP_003900273.1.30101 WP_003900273.1.30106 WP_003900273.1.30114 WP_003900273.1.30126 WP_003900273.1.30131 WP_003900273.1.30138 WP_003900273.1.30139 WP_003900273.1.30145 WP_003900273.1.30211 WP_003900273.1.30224 WP_003900273.1.3027 WP_003900273.1.30279 WP_003900273.1.30282 WP_003900273.1.30283 WP_003900273.1.30291 WP_003900273.1.30363 WP_003900273.1.30374 WP_003900273.1.30404 WP_003900273.1.30433 WP_003900273.1.30462 WP_003900273.1.30464 WP_003900273.1.30468 WP_003900273.1.30500 WP_003900273.1.30574 WP_003900273.1.30628 WP_003900273.1.30641 WP_003900273.1.30642 WP_003900273.1.30661 WP_003900273.1.30669 WP_003900273.1.30683 WP_003900273.1.30699 WP_003900273.1.30730 WP_003900273.1.30732 WP_003900273.1.30736 WP_003900273.1.30745 WP_003900273.1.30760 WP_003900273.1.30791 WP_003900273.1.308 WP_003900273.1.30824 WP_003900273.1.30877 WP_003900273.1.30888 WP_003900273.1.30901 WP_003900273.1.30903 WP_003900273.1.30912 WP_003900273.1.30913 WP_003900273.1.30914 WP_003900273.1.30919 WP_003900273.1.3100 WP_003900273.1.3101 WP_003900273.1.31034 WP_003900273.1.31047 WP_003900273.1.31070 WP_003900273.1.31102 WP_003900273.1.31184 WP_003900273.1.31226 WP_003900273.1.31233 WP_003900273.1.31270 WP_003900273.1.31287 WP_003900273.1.31290 WP_003900273.1.31304 WP_003900273.1.31346 WP_003900273.1.31348 WP_003900273.1.31354 WP_003900273.1.31428 WP_003900273.1.31458 WP_003900273.1.3149 WP_003900273.1.31498 WP_003900273.1.31507 WP_003900273.1.31537 WP_003900273.1.31569 WP_003900273.1.31573 WP_003900273.1.316 WP_003900273.1.31629 WP_003900273.1.31744 WP_003900273.1.31776 WP_003900273.1.31783 WP_003900273.1.318 WP_003900273.1.3184 WP_003900273.1.31840 WP_003900273.1.31880 WP_003900273.1.31911 WP_003900273.1.31955 WP_003900273.1.31991 WP_003900273.1.32004 WP_003900273.1.32039 WP_003900273.1.3204 WP_003900273.1.32045 WP_003900273.1.32071 WP_003900273.1.32132 WP_003900273.1.32157 WP_003900273.1.32164 WP_003900273.1.32179 WP_003900273.1.32317 WP_003900273.1.32383 WP_003900273.1.32400 WP_003900273.1.32403 WP_003900273.1.32416 WP_003900273.1.32421 WP_003900273.1.32461 WP_003900273.1.32482 WP_003900273.1.32503 WP_003900273.1.32562 WP_003900273.1.32569 WP_003900273.1.32592 WP_003900273.1.32647 WP_003900273.1.32653 WP_003900273.1.32654 WP_003900273.1.3268 WP_003900273.1.32695 WP_003900273.1.32706 WP_003900273.1.32716 WP_003900273.1.32752 WP_003900273.1.32780 WP_003900273.1.32781 WP_003900273.1.32793 WP_003900273.1.32799 WP_003900273.1.32822 WP_003900273.1.32833 WP_003900273.1.32862 WP_003900273.1.32880 WP_003900273.1.32897 WP_003900273.1.32909 WP_003900273.1.32974 WP_003900273.1.33007 WP_003900273.1.3302 WP_003900273.1.33028 WP_003900273.1.33035 WP_003900273.1.33044 WP_003900273.1.33054 WP_003900273.1.33082 WP_003900273.1.33141 WP_003900273.1.33148 WP_003900273.1.33155 WP_003900273.1.33168 WP_003900273.1.3321 WP_003900273.1.33215 WP_003900273.1.3325 WP_003900273.1.33278 WP_003900273.1.33288 WP_003900273.1.33305 WP_003900273.1.3331 WP_003900273.1.3333 WP_003900273.1.33393 WP_003900273.1.33403 WP_003900273.1.33452 WP_003900273.1.33467 WP_003900273.1.3349 WP_003900273.1.33519 WP_003900273.1.33542 WP_003900273.1.33601 WP_003900273.1.33633 WP_003900273.1.33646 WP_003900273.1.33673 WP_003900273.1.3369 WP_003900273.1.33705 WP_003900273.1.33762 WP_003900273.1.33783 WP_003900273.1.33789 WP_003900273.1.3383 WP_003900273.1.33832 WP_003900273.1.33839 WP_003900273.1.3387 WP_003900273.1.33886 WP_003900273.1.33906 WP_003900273.1.33912 WP_003900273.1.33954 WP_003900273.1.3399 WP_003900273.1.34042 WP_003900273.1.3405 WP_003900273.1.34055 WP_003900273.1.34056 WP_003900273.1.34065 WP_003900273.1.3408 WP_003900273.1.34090 WP_003900273.1.34109 WP_003900273.1.34111 WP_003900273.1.34131 WP_003900273.1.34152 WP_003900273.1.34153 WP_003900273.1.34163 WP_003900273.1.34181 WP_003900273.1.34197 WP_003900273.1.34198 WP_003900273.1.34215 WP_003900273.1.34219 WP_003900273.1.34255 WP_003900273.1.34260 WP_003900273.1.34275 WP_003900273.1.343 WP_003900273.1.34358 WP_003900273.1.344 WP_003900273.1.34428 WP_003900273.1.3443 WP_003900273.1.34435 WP_003900273.1.34446 WP_003900273.1.34505 WP_003900273.1.34516 WP_003900273.1.34529 WP_003900273.1.34551 WP_003900273.1.34563 WP_003900273.1.34576 WP_003900273.1.34588 WP_003900273.1.34599 WP_003900273.1.34639 WP_003900273.1.34673 WP_003900273.1.34740 WP_003900273.1.34755 WP_003900273.1.34783 WP_003900273.1.34908 WP_003900273.1.3492 WP_003900273.1.34933 WP_003900273.1.34946 WP_003900273.1.34954 WP_003900273.1.34961 WP_003900273.1.34963 WP_003900273.1.34968 WP_003900273.1.35023 WP_003900273.1.35069 WP_003900273.1.35072 WP_003900273.1.35078 WP_003900273.1.35100 WP_003900273.1.35146 WP_003900273.1.35156 WP_003900273.1.35160 WP_003900273.1.35162 WP_003900273.1.35173 WP_003900273.1.3520 WP_003900273.1.35213 WP_003900273.1.35246 WP_003900273.1.35278 WP_003900273.1.35301 WP_003900273.1.35311 WP_003900273.1.35312 WP_003900273.1.35319 WP_003900273.1.35347 WP_003900273.1.35363 WP_003900273.1.35385 WP_003900273.1.35396 WP_003900273.1.35397 WP_003900273.1.35426 WP_003900273.1.35439 WP_003900273.1.35455 WP_003900273.1.35484 WP_003900273.1.35492 WP_003900273.1.3553 WP_003900273.1.35555 WP_003900273.1.35561 WP_003900273.1.35602 WP_003900273.1.35610 WP_003900273.1.35657 WP_003900273.1.35680 WP_003900273.1.35689 WP_003900273.1.35767 WP_003900273.1.35770 WP_003900273.1.35780 WP_003900273.1.35805 WP_003900273.1.35811 WP_003900273.1.35821 WP_003900273.1.3584 WP_003900273.1.35864 WP_003900273.1.35874 WP_003900273.1.35876 WP_003900273.1.35897 WP_003900273.1.35923 WP_003900273.1.3593 WP_003900273.1.36005 WP_003900273.1.36023 WP_003900273.1.36051 WP_003900273.1.36053 WP_003900273.1.36089 WP_003900273.1.36097 WP_003900273.1.36116 WP_003900273.1.36145 WP_003900273.1.36156 WP_003900273.1.36228 WP_003900273.1.36246 WP_003900273.1.36252 WP_003900273.1.36260 WP_003900273.1.36270 WP_003900273.1.36271 WP_003900273.1.36303 WP_003900273.1.36309 WP_003900273.1.36315 WP_003900273.1.36321 WP_003900273.1.36326 WP_003900273.1.3634 WP_003900273.1.36357 WP_003900273.1.3636 WP_003900273.1.36436 WP_003900273.1.36465 WP_003900273.1.36469 WP_003900273.1.36473 WP_003900273.1.36485 WP_003900273.1.36508 WP_003900273.1.36561 WP_003900273.1.36573 WP_003900273.1.36585 WP_003900273.1.36597 WP_003900273.1.36614 WP_003900273.1.36657 WP_003900273.1.36674 WP_003900273.1.36720 WP_003900273.1.36727 WP_003900273.1.36785 WP_003900273.1.36810 WP_003900273.1.36844 WP_003900273.1.36851 WP_003900273.1.36862 WP_003900273.1.36901 WP_003900273.1.36921 WP_003900273.1.36935 WP_003900273.1.36941 WP_003900273.1.3695 WP_003900273.1.36951 WP_003900273.1.37004 WP_003900273.1.37012 WP_003900273.1.37071 WP_003900273.1.37088 WP_003900273.1.37131 WP_003900273.1.37157 WP_003900273.1.37188 WP_003900273.1.37213 WP_003900273.1.3724 WP_003900273.1.37277 WP_003900273.1.37305 WP_003900273.1.37330 WP_003900273.1.37440 WP_003900273.1.37468 WP_003900273.1.37601 WP_003900273.1.37612 WP_003900273.1.37632 WP_003900273.1.37643 WP_003900273.1.37655 WP_003900273.1.37674 WP_003900273.1.37700 WP_003900273.1.37701 WP_003900273.1.37709 WP_003900273.1.37711 WP_003900273.1.37747 WP_003900273.1.37765 WP_003900273.1.37772 WP_003900273.1.37804 WP_003900273.1.37859 WP_003900273.1.37877 WP_003900273.1.37912 WP_003900273.1.37913 WP_003900273.1.37943 WP_003900273.1.37950 WP_003900273.1.37983 WP_003900273.1.38002 WP_003900273.1.3802 WP_003900273.1.38039 WP_003900273.1.38040 WP_003900273.1.38067 WP_003900273.1.38135 WP_003900273.1.38138 WP_003900273.1.38159 WP_003900273.1.38210 WP_003900273.1.38233 WP_003900273.1.38240 WP_003900273.1.38299 WP_003900273.1.38347 WP_003900273.1.38354 WP_003900273.1.38380 WP_003900273.1.38384 WP_003900273.1.38389 WP_003900273.1.38402 WP_003900273.1.38418 WP_003900273.1.38477 WP_003900273.1.38483 WP_003900273.1.3849 WP_003900273.1.38535 WP_003900273.1.38539 WP_003900273.1.38601 WP_003900273.1.38611 WP_003900273.1.38638 WP_003900273.1.38639 WP_003900273.1.38646 WP_003900273.1.38648 WP_003900273.1.38654 WP_003900273.1.38659 WP_003900273.1.38666 WP_003900273.1.38671 WP_003900273.1.38677 WP_003900273.1.38750 WP_003900273.1.38812 WP_003900273.1.38844 WP_003900273.1.38863 WP_003900273.1.38865 WP_003900273.1.38873 WP_003900273.1.38894 WP_003900273.1.38909 WP_003900273.1.38939 WP_003900273.1.38974 WP_003900273.1.38975 WP_003900273.1.39025 WP_003900273.1.39070 WP_003900273.1.39072 WP_003900273.1.39095 WP_003900273.1.39106 WP_003900273.1.39165 WP_003900273.1.39174 WP_003900273.1.39176 WP_003900273.1.39178 WP_003900273.1.39201 WP_003900273.1.39207 WP_003900273.1.39211 WP_003900273.1.39239 WP_003900273.1.39252 WP_003900273.1.39288 WP_003900273.1.39359 WP_003900273.1.39364 WP_003900273.1.39400 WP_003900273.1.39447 WP_003900273.1.3945 WP_003900273.1.39450 WP_003900273.1.39455 WP_003900273.1.3949 WP_003900273.1.39560 WP_003900273.1.39592 WP_003900273.1.39593 WP_003900273.1.396 WP_003900273.1.3960 WP_003900273.1.39654 WP_003900273.1.39657 WP_003900273.1.39661 WP_003900273.1.39674 WP_003900273.1.39678 WP_003900273.1.3968 WP_003900273.1.39694 WP_003900273.1.3971 WP_003900273.1.39718 WP_003900273.1.39728 WP_003900273.1.39739 WP_003900273.1.39748 WP_003900273.1.39751 WP_003900273.1.39801 WP_003900273.1.39804 WP_003900273.1.39877 WP_003900273.1.39925 WP_003900273.1.3996 WP_003900273.1.39980 WP_003900273.1.40000 WP_003900273.1.40028 WP_003900273.1.40029 WP_003900273.1.4003 WP_003900273.1.40094 WP_003900273.1.40096 WP_003900273.1.40156 WP_003900273.1.40174 WP_003900273.1.40276 WP_003900273.1.40353 WP_003900273.1.40372 WP_003900273.1.40440 WP_003900273.1.40446 WP_003900273.1.40451 WP_003900273.1.40455 WP_003900273.1.40523 WP_003900273.1.40543 WP_003900273.1.40641 WP_003900273.1.40651 WP_003900273.1.40653 WP_003900273.1.4067 WP_003900273.1.40705 WP_003900273.1.40723 WP_003900273.1.40731 WP_003900273.1.40735 WP_003900273.1.40795 WP_003900273.1.40799 WP_003900273.1.40852 WP_003900273.1.40881 WP_003900273.1.40922 WP_003900273.1.40948 WP_003900273.1.4095 WP_003900273.1.40956 WP_003900273.1.40957 WP_003900273.1.40964 WP_003900273.1.4097 WP_003900273.1.410 WP_003900273.1.41000 WP_003900273.1.41055 WP_003900273.1.41108 WP_003900273.1.41123 WP_003900273.1.41177 WP_003900273.1.41219 WP_003900273.1.41249 WP_003900273.1.4127 WP_003900273.1.41296 WP_003900273.1.41355 WP_003900273.1.41376 WP_003900273.1.41430 WP_003900273.1.41553 WP_003900273.1.41583 WP_003900273.1.41616 WP_003900273.1.41636 WP_003900273.1.41648 WP_003900273.1.41660 WP_003900273.1.41685 WP_003900273.1.41695 WP_003900273.1.41704 WP_003900273.1.4171 WP_003900273.1.41719 WP_003900273.1.41733 WP_003900273.1.41774 WP_003900273.1.41803 WP_003900273.1.41820 WP_003900273.1.41828 WP_003900273.1.41860 WP_003900273.1.41912 WP_003900273.1.41933 WP_003900273.1.41944 WP_003900273.1.42075 WP_003900273.1.42078 WP_003900273.1.42094 WP_003900273.1.42112 WP_003900273.1.4212 WP_003900273.1.42183 WP_003900273.1.42188 WP_003900273.1.42201 WP_003900273.1.42202 WP_003900273.1.42208 WP_003900273.1.42247 WP_003900273.1.42255 WP_003900273.1.42273 WP_003900273.1.42278 WP_003900273.1.42304 WP_003900273.1.42309 WP_003900273.1.42370 WP_003900273.1.42385 WP_003900273.1.42400 WP_003900273.1.42414 WP_003900273.1.42417 WP_003900273.1.42430 WP_003900273.1.42461 WP_003900273.1.42465 WP_003900273.1.42473 WP_003900273.1.42474 WP_003900273.1.4248 WP_003900273.1.42519 WP_003900273.1.42534 WP_003900273.1.4255 WP_003900273.1.42562 WP_003900273.1.42568 WP_003900273.1.42570 WP_003900273.1.42618 WP_003900273.1.42660 WP_003900273.1.42695 WP_003900273.1.42777 WP_003900273.1.42782 WP_003900273.1.42835 WP_003900273.1.42839 WP_003900273.1.42916 WP_003900273.1.42930 WP_003900273.1.42971 WP_003900273.1.43082 WP_003900273.1.43087 WP_003900273.1.43098 WP_003900273.1.43208 WP_003900273.1.43236 WP_003900273.1.43246 WP_003900273.1.43255 WP_003900273.1.43266 WP_003900273.1.43269 WP_003900273.1.43306 WP_003900273.1.4335 WP_003900273.1.43368 WP_003900273.1.43395 WP_003900273.1.43457 WP_003900273.1.43462 WP_003900273.1.43478 WP_003900273.1.43484 WP_003900273.1.43557 WP_003900273.1.43578 WP_003900273.1.43588 WP_003900273.1.43643 WP_003900273.1.43664 WP_003900273.1.43684 WP_003900273.1.43686 WP_003900273.1.43706 WP_003900273.1.43716 WP_003900273.1.43781 WP_003900273.1.43794 WP_003900273.1.43846 WP_003900273.1.43863 WP_003900273.1.43866 WP_003900273.1.43902 WP_003900273.1.43936 WP_003900273.1.43937 WP_003900273.1.43965 WP_003900273.1.4399 WP_003900273.1.43993 WP_003900273.1.43996 WP_003900273.1.44008 WP_003900273.1.44016 WP_003900273.1.44037 WP_003900273.1.44041 WP_003900273.1.44070 WP_003900273.1.44071 WP_003900273.1.44104 WP_003900273.1.44111 WP_003900273.1.44124 WP_003900273.1.44219 WP_003900273.1.44237 WP_003900273.1.44279 WP_003900273.1.44336 WP_003900273.1.44358 WP_003900273.1.4438 WP_003900273.1.44392 WP_003900273.1.4441 WP_003900273.1.44415 WP_003900273.1.44464 WP_003900273.1.44466 WP_003900273.1.44489 WP_003900273.1.44492 WP_003900273.1.44494 WP_003900273.1.44500 WP_003900273.1.44519 WP_003900273.1.44526 WP_003900273.1.44589 WP_003900273.1.44597 WP_003900273.1.44600 WP_003900273.1.44615 WP_003900273.1.44665 WP_003900273.1.44700 WP_003900273.1.44713 WP_003900273.1.44735 WP_003900273.1.44740 WP_003900273.1.44757 WP_003900273.1.44761 WP_003900273.1.44767 WP_003900273.1.44786 WP_003900273.1.44808 WP_003900273.1.44864 WP_003900273.1.44901 WP_003900273.1.44908 WP_003900273.1.44939 WP_003900273.1.45011 WP_003900273.1.4504 WP_003900273.1.45066 WP_003900273.1.45113 WP_003900273.1.45135 WP_003900273.1.45147 WP_003900273.1.45168 WP_003900273.1.4517 WP_003900273.1.45181 WP_003900273.1.45185 WP_003900273.1.45192 WP_003900273.1.45200 WP_003900273.1.45205 WP_003900273.1.45249 WP_003900273.1.4526 WP_003900273.1.45286 WP_003900273.1.45347 WP_003900273.1.45390 WP_003900273.1.454 WP_003900273.1.45453 WP_003900273.1.45460 WP_003900273.1.45463 WP_003900273.1.45470 WP_003900273.1.45491 WP_003900273.1.45563 WP_003900273.1.45584 WP_003900273.1.45590 WP_003900273.1.45666 WP_003900273.1.45697 WP_003900273.1.45731 WP_003900273.1.45743 WP_003900273.1.45765 WP_003900273.1.45776 WP_003900273.1.45783 WP_003900273.1.45815 WP_003900273.1.45849 WP_003900273.1.45867 WP_003900273.1.45884 WP_003900273.1.4590 WP_003900273.1.45923 WP_003900273.1.45926 WP_003900273.1.45989 WP_003900273.1.45992 WP_003900273.1.46025 WP_003900273.1.46090 WP_003900273.1.46100 WP_003900273.1.46101 WP_003900273.1.46103 WP_003900273.1.46107 WP_003900273.1.46127 WP_003900273.1.46128 WP_003900273.1.46141 WP_003900273.1.46150 WP_003900273.1.46201 WP_003900273.1.46226 WP_003900273.1.46253 WP_003900273.1.46268 WP_003900273.1.46285 WP_003900273.1.46300 WP_003900273.1.46313 WP_003900273.1.46365 WP_003900273.1.46370 WP_003900273.1.46381 WP_003900273.1.46402 WP_003900273.1.4644 WP_003900273.1.46453 WP_003900273.1.46463 WP_003900273.1.46478 WP_003900273.1.46492 WP_003900273.1.46521 WP_003900273.1.4653 WP_003900273.1.46532 WP_003900273.1.46539 WP_003900273.1.46585 WP_003900273.1.46609 WP_003900273.1.46613 WP_003900273.1.46674 WP_003900273.1.46724 WP_003900273.1.46758 WP_003900273.1.46773 WP_003900273.1.46777 WP_003900273.1.46786 WP_003900273.1.46847 WP_003900273.1.46851 WP_003900273.1.4687 WP_003900273.1.46936 WP_003900273.1.47011 WP_003900273.1.47012 WP_003900273.1.47077 WP_003900273.1.47083 WP_003900273.1.47106 WP_003900273.1.47142 WP_003900273.1.47147 WP_003900273.1.47166 WP_003900273.1.47178 WP_003900273.1.47179 WP_003900273.1.47207 WP_003900273.1.47210 WP_003900273.1.47261 WP_003900273.1.47262 WP_003900273.1.47402 WP_003900273.1.47423 WP_003900273.1.47467 WP_003900273.1.47502 WP_003900273.1.4751 WP_003900273.1.47511 WP_003900273.1.47537 WP_003900273.1.47568 WP_003900273.1.4764 WP_003900273.1.47653 WP_003900273.1.47681 WP_003900273.1.47690 WP_003900273.1.4771 WP_003900273.1.47717 WP_003900273.1.47743 WP_003900273.1.47754 WP_003900273.1.47773 WP_003900273.1.47776 WP_003900273.1.47780 WP_003900273.1.47847 WP_003900273.1.47858 WP_003900273.1.47861 WP_003900273.1.47868 WP_003900273.1.47893 WP_003900273.1.479 WP_003900273.1.47913 WP_003900273.1.4794 WP_003900273.1.47943 WP_003900273.1.47944 WP_003900273.1.48004 WP_003900273.1.48039 WP_003900273.1.48050 WP_003900273.1.48084 WP_003900273.1.48097 WP_003900273.1.48101 WP_003900273.1.48109 WP_003900273.1.4813 WP_003900273.1.48135 WP_003900273.1.48152 WP_003900273.1.48173 WP_003900273.1.48177 WP_003900273.1.48204 WP_003900273.1.48219 WP_003900273.1.4823 WP_003900273.1.48240 WP_003900273.1.48330 WP_003900273.1.48348 WP_003900273.1.48354 WP_003900273.1.48372 WP_003900273.1.48383 WP_003900273.1.48388 WP_003900273.1.48419 WP_003900273.1.48423 WP_003900273.1.48450 WP_003900273.1.48462 WP_003900273.1.48543 WP_003900273.1.48550 WP_003900273.1.48605 WP_003900273.1.48618 WP_003900273.1.4863 WP_003900273.1.48648 WP_003900273.1.48779 WP_003900273.1.48798 WP_003900273.1.48802 WP_003900273.1.48826 WP_003900273.1.48831 WP_003900273.1.48843 WP_003900273.1.48857 WP_003900273.1.48979 WP_003900273.1.49017 WP_003900273.1.49048 WP_003900273.1.49059 WP_003900273.1.4906 WP_003900273.1.4907 WP_003900273.1.49103 WP_003900273.1.49110 WP_003900273.1.49111 WP_003900273.1.49112 WP_003900273.1.49254 WP_003900273.1.49263 WP_003900273.1.49296 WP_003900273.1.49337 WP_003900273.1.49419 WP_003900273.1.49426 WP_003900273.1.49439 WP_003900273.1.49474 WP_003900273.1.49516 WP_003900273.1.49523 WP_003900273.1.49526 WP_003900273.1.49532 WP_003900273.1.49588 WP_003900273.1.49678 WP_003900273.1.49709 WP_003900273.1.4971 WP_003900273.1.4972 WP_003900273.1.49736 WP_003900273.1.49746 WP_003900273.1.49764 WP_003900273.1.49773 WP_003900273.1.49814 WP_003900273.1.49815 WP_003900273.1.49816 WP_003900273.1.49839 WP_003900273.1.49857 WP_003900273.1.49878 WP_003900273.1.49880 WP_003900273.1.49944 WP_003900273.1.49990 WP_003900273.1.50077 WP_003900273.1.50081 WP_003900273.1.50122 WP_003900273.1.50149 WP_003900273.1.5018 WP_003900273.1.50194 WP_003900273.1.50218 WP_003900273.1.50235 WP_003900273.1.50249 WP_003900273.1.50271 WP_003900273.1.50324 WP_003900273.1.50372 WP_003900273.1.50398 WP_003900273.1.50407 WP_003900273.1.50444 WP_003900273.1.50466 WP_003900273.1.50472 WP_003900273.1.50498 WP_003900273.1.50540 WP_003900273.1.50554 WP_003900273.1.50557 WP_003900273.1.50601 WP_003900273.1.50610 WP_003900273.1.50633 WP_003900273.1.50642 WP_003900273.1.50659 WP_003900273.1.50683 WP_003900273.1.50689 WP_003900273.1.50692 WP_003900273.1.50714 WP_003900273.1.50729 WP_003900273.1.50794 WP_003900273.1.50841 WP_003900273.1.50860 WP_003900273.1.50868 WP_003900273.1.50877 WP_003900273.1.5096 WP_003900273.1.50981 WP_003900273.1.50987 WP_003900273.1.51003 WP_003900273.1.51082 WP_003900273.1.51101 WP_003900273.1.51116 WP_003900273.1.51149 WP_003900273.1.51156 WP_003900273.1.51157 WP_003900273.1.51213 WP_003900273.1.51232 WP_003900273.1.51239 WP_003900273.1.51247 WP_003900273.1.51266 WP_003900273.1.51279 WP_003900273.1.51291 WP_003900273.1.51294 WP_003900273.1.51301 WP_003900273.1.51329 WP_003900273.1.51391 WP_003900273.1.51422 WP_003900273.1.51468 WP_003900273.1.51478 WP_003900273.1.51520 WP_003900273.1.51593 WP_003900273.1.51628 WP_003900273.1.5164 WP_003900273.1.51647 WP_003900273.1.51660 WP_003900273.1.51721 WP_003900273.1.51788 WP_003900273.1.51801 WP_003900273.1.51817 WP_003900273.1.51819 WP_003900273.1.51854 WP_003900273.1.51923 WP_003900273.1.51942 WP_003900273.1.51948 WP_003900273.1.51963 WP_003900273.1.51969 WP_003900273.1.52000 WP_003900273.1.52001 WP_003900273.1.52036 WP_003900273.1.52038 WP_003900273.1.52046 WP_003900273.1.52059 WP_003900273.1.52069 WP_003900273.1.52106 WP_003900273.1.52166 WP_003900273.1.52168 WP_003900273.1.52173 WP_003900273.1.52238 WP_003900273.1.52241 WP_003900273.1.52280 WP_003900273.1.52314 WP_003900273.1.52385 WP_003900273.1.52460 WP_003900273.1.52485 WP_003900273.1.52486 WP_003900273.1.52504 WP_003900273.1.52522 WP_003900273.1.52531 WP_003900273.1.52563 WP_003900273.1.52564 WP_003900273.1.52673 WP_003900273.1.52674 WP_003900273.1.52708 WP_003900273.1.52713 WP_003900273.1.52761 WP_003900273.1.52778 WP_003900273.1.52791 WP_003900273.1.52797 WP_003900273.1.52818 WP_003900273.1.52873 WP_003900273.1.52909 WP_003900273.1.52998 WP_003900273.1.53056 WP_003900273.1.5306 WP_003900273.1.53088 WP_003900273.1.53117 WP_003900273.1.53118 WP_003900273.1.53142 WP_003900273.1.53143 WP_003900273.1.53167 WP_003900273.1.53200 WP_003900273.1.53204 WP_003900273.1.53226 WP_003900273.1.53230 WP_003900273.1.53237 WP_003900273.1.5327 WP_003900273.1.53276 WP_003900273.1.533 WP_003900273.1.53302 WP_003900273.1.53306 WP_003900273.1.5334 WP_003900273.1.5335 WP_003900273.1.53413 WP_003900273.1.53458 WP_003900273.1.53460 WP_003900273.1.53522 WP_003900273.1.53525 WP_003900273.1.53526 WP_003900273.1.53553 WP_003900273.1.53609 WP_003900273.1.53628 WP_003900273.1.53643 WP_003900273.1.53667 WP_003900273.1.53679 WP_003900273.1.53715 WP_003900273.1.53742 WP_003900273.1.53743 WP_003900273.1.53775 WP_003900273.1.53787 WP_003900273.1.53818 WP_003900273.1.53822 WP_003900273.1.53853 WP_003900273.1.53865 WP_003900273.1.53900 WP_003900273.1.53912 WP_003900273.1.53914 WP_003900273.1.5398 WP_003900273.1.5408 WP_003900273.1.54089 WP_003900273.1.54093 WP_003900273.1.54099 WP_003900273.1.54112 WP_003900273.1.54125 WP_003900273.1.54141 WP_003900273.1.54206 WP_003900273.1.54218 WP_003900273.1.54225 WP_003900273.1.54227 WP_003900273.1.54232 WP_003900273.1.54241 WP_003900273.1.54245 WP_003900273.1.54247 WP_003900273.1.54260 WP_003900273.1.54280 WP_003900273.1.5429 WP_003900273.1.54294 WP_003900273.1.54314 WP_003900273.1.54347 WP_003900273.1.54370 WP_003900273.1.54428 WP_003900273.1.54449 WP_003900273.1.54494 WP_003900273.1.54502 WP_003900273.1.54514 WP_003900273.1.54519 WP_003900273.1.5452 WP_003900273.1.54555 WP_003900273.1.54575 WP_003900273.1.54633 WP_003900273.1.54686 WP_003900273.1.54687 WP_003900273.1.54730 WP_003900273.1.5475 WP_003900273.1.54797 WP_003900273.1.54807 WP_003900273.1.54838 WP_003900273.1.54897 WP_003900273.1.54905 WP_003900273.1.54937 WP_003900273.1.54939 WP_003900273.1.54944 WP_003900273.1.54945 WP_003900273.1.55015 WP_003900273.1.55022 WP_003900273.1.55051 WP_003900273.1.55072 WP_003900273.1.55088 WP_003900273.1.55106 WP_003900273.1.55126 WP_003900273.1.55150 WP_003900273.1.55248 WP_003900273.1.55258 WP_003900273.1.55267 WP_003900273.1.55279 WP_003900273.1.55326 WP_003900273.1.5533 WP_003900273.1.55345 WP_003900273.1.55396 WP_003900273.1.55398 WP_003900273.1.55441 WP_003900273.1.55459 WP_003900273.1.55501 WP_003900273.1.55504 WP_003900273.1.55641 WP_003900273.1.5569 WP_003900273.1.55735 WP_003900273.1.55772 WP_003900273.1.55802 WP_003900273.1.55807 WP_003900273.1.55821 WP_003900273.1.5583 WP_003900273.1.55856 WP_003900273.1.55860 WP_003900273.1.55883 WP_003900273.1.55902 WP_003900273.1.5591 WP_003900273.1.55961 WP_003900273.1.55977 WP_003900273.1.55983 WP_003900273.1.56028 WP_003900273.1.56057 WP_003900273.1.56060 WP_003900273.1.56107 WP_003900273.1.56132 WP_003900273.1.56163 WP_003900273.1.56167 WP_003900273.1.56287 WP_003900273.1.56327 WP_003900273.1.56341 WP_003900273.1.56359 WP_003900273.1.56394 WP_003900273.1.56443 WP_003900273.1.56473 WP_003900273.1.56500 WP_003900273.1.56517 WP_003900273.1.56534 WP_003900273.1.5656 WP_003900273.1.56593 WP_003900273.1.56625 WP_003900273.1.56637 WP_003900273.1.56670 WP_003900273.1.56697 WP_003900273.1.56709 WP_003900273.1.56729 WP_003900273.1.56755 WP_003900273.1.56764 WP_003900273.1.56769 WP_003900273.1.56770 WP_003900273.1.56795 WP_003900273.1.5681 WP_003900273.1.56827 WP_003900273.1.56839 WP_003900273.1.56868 WP_003900273.1.56915 WP_003900273.1.56961 WP_003900273.1.56971 WP_003900273.1.56972 WP_003900273.1.57035 WP_003900273.1.57077 WP_003900273.1.57087 WP_003900273.1.57094 WP_003900273.1.57151 WP_003900273.1.57169 WP_003900273.1.57208 WP_003900273.1.57212 WP_003900273.1.57230 WP_003900273.1.5725 WP_003900273.1.5727 WP_003900273.1.57273 WP_003900273.1.573 WP_003900273.1.57314 WP_003900273.1.57351 WP_003900273.1.57352 WP_003900273.1.57380 WP_003900273.1.57430 WP_003900273.1.5744 WP_003900273.1.5745 WP_003900273.1.57461 WP_003900273.1.57469 WP_003900273.1.57509 WP_003900273.1.57525 WP_003900273.1.57551 WP_003900273.1.5758 WP_003900273.1.57596 WP_003900273.1.57604 WP_003900273.1.57616 WP_003900273.1.57617 WP_003900273.1.57619 WP_003900273.1.57642 WP_003900273.1.57658 WP_003900273.1.57667 WP_003900273.1.57675 WP_003900273.1.57689 WP_003900273.1.57708 WP_003900273.1.57794 WP_003900273.1.57821 WP_003900273.1.57843 WP_003900273.1.57906 WP_003900273.1.57924 WP_003900273.1.57926 WP_003900273.1.57930 WP_003900273.1.57957 WP_003900273.1.57960 WP_003900273.1.57964 WP_003900273.1.58000 WP_003900273.1.58086 WP_003900273.1.58101 WP_003900273.1.58108 WP_003900273.1.58121 WP_003900273.1.58164 WP_003900273.1.582 WP_003900273.1.58202 WP_003900273.1.58209 WP_003900273.1.58215 WP_003900273.1.5824 WP_003900273.1.58250 WP_003900273.1.58259 WP_003900273.1.58283 WP_003900273.1.58288 WP_003900273.1.5830 WP_003900273.1.58303 WP_003900273.1.58311 WP_003900273.1.58359 WP_003900273.1.58431 WP_003900273.1.58457 WP_003900273.1.58488 WP_003900273.1.58518 WP_003900273.1.58534 WP_003900273.1.58567 WP_003900273.1.58573 WP_003900273.1.58602 WP_003900273.1.58612 WP_003900273.1.5865 WP_003900273.1.58671 WP_003900273.1.58690 WP_003900273.1.58702 WP_003900273.1.58743 WP_003900273.1.58754 WP_003900273.1.5881 WP_003900273.1.58824 WP_003900273.1.58848 WP_003900273.1.58857 WP_003900273.1.58891 WP_003900273.1.58892 WP_003900273.1.5890 WP_003900273.1.58904 WP_003900273.1.58921 WP_003900273.1.58930 WP_003900273.1.58939 WP_003900273.1.58941 WP_003900273.1.58953 WP_003900273.1.58961 WP_003900273.1.5898 WP_003900273.1.59025 WP_003900273.1.59029 WP_003900273.1.59037 WP_003900273.1.59044 WP_003900273.1.59085 WP_003900273.1.59088 WP_003900273.1.59112 WP_003900273.1.59130 WP_003900273.1.5914 WP_003900273.1.59147 WP_003900273.1.59209 WP_003900273.1.59240 WP_003900273.1.59253 WP_003900273.1.59262 WP_003900273.1.5928 WP_003900273.1.59304 WP_003900273.1.59316 WP_003900273.1.59326 WP_003900273.1.59328 WP_003900273.1.59338 WP_003900273.1.59388 WP_003900273.1.59428 WP_003900273.1.59537 WP_003900273.1.59677 WP_003900273.1.59727 WP_003900273.1.59738 WP_003900273.1.59757 WP_003900273.1.59761 WP_003900273.1.59808 WP_003900273.1.59850 WP_003900273.1.59856 WP_003900273.1.59861 WP_003900273.1.5987 WP_003900273.1.59878 WP_003900273.1.59888 WP_003900273.1.5996 WP_003900273.1.59961 WP_003900273.1.60007 WP_003900273.1.60016 WP_003900273.1.6003 WP_003900273.1.60047 WP_003900273.1.6007 WP_003900273.1.60121 WP_003900273.1.60135 WP_003900273.1.60139 WP_003900273.1.60152 WP_003900273.1.60197 WP_003900273.1.60205 WP_003900273.1.60215 WP_003900273.1.60217 WP_003900273.1.60267 WP_003900273.1.60288 WP_003900273.1.60291 WP_003900273.1.60301 WP_003900273.1.60305 WP_003900273.1.60312 WP_003900273.1.60313 WP_003900273.1.60314 WP_003900273.1.60367 WP_003900273.1.60376 WP_003900273.1.60403 WP_003900273.1.60413 WP_003900273.1.60421 WP_003900273.1.60451 WP_003900273.1.60460 WP_003900273.1.60479 WP_003900273.1.60487 WP_003900273.1.60512 WP_003900273.1.60573 WP_003900273.1.60583 WP_003900273.1.60632 WP_003900273.1.60657 WP_003900273.1.60687 WP_003900273.1.60689 WP_003900273.1.60727 WP_003900273.1.60738 WP_003900273.1.60763 WP_003900273.1.60791 WP_003900273.1.60834 WP_003900273.1.60870 WP_003900273.1.60878 WP_003900273.1.60879 WP_003900273.1.60913 WP_003900273.1.60978 WP_003900273.1.61001 WP_003900273.1.61012 WP_003900273.1.61052 WP_003900273.1.61065 WP_003900273.1.61100 WP_003900273.1.61101 WP_003900273.1.61142 WP_003900273.1.61198 WP_003900273.1.61234 WP_003900273.1.61256 WP_003900273.1.61281 WP_003900273.1.61368 WP_003900273.1.61420 WP_003900273.1.61422 WP_003900273.1.61428 WP_003900273.1.61469 WP_003900273.1.61494 WP_003900273.1.61522 WP_003900273.1.61552 WP_003900273.1.61567 WP_003900273.1.61573 WP_003900273.1.61584 WP_003900273.1.61586 WP_003900273.1.6159 WP_003900273.1.61592 WP_003900273.1.6160 WP_003900273.1.61614 WP_003900273.1.6163 WP_003900273.1.61655 WP_003900273.1.61669 WP_003900273.1.61682 WP_003900273.1.61692 WP_003900273.1.61728 WP_003900273.1.61750 WP_003900273.1.61754 WP_003900273.1.61755 WP_003900273.1.61757 WP_003900273.1.61778 WP_003900273.1.61793 WP_003900273.1.61816 WP_003900273.1.61842 WP_003900273.1.61850 WP_003900273.1.61868 WP_003900273.1.61911 WP_003900273.1.61925 WP_003900273.1.61941 WP_003900273.1.61953 WP_003900273.1.61979 WP_003900273.1.61986 WP_003900273.1.61998 WP_003900273.1.62021 WP_003900273.1.62087 WP_003900273.1.62089 WP_003900273.1.62104 WP_003900273.1.6211 WP_003900273.1.62162 WP_003900273.1.62225 WP_003900273.1.62230 WP_003900273.1.62249 WP_003900273.1.62270 WP_003900273.1.62281 WP_003900273.1.62307 WP_003900273.1.6231 WP_003900273.1.62359 WP_003900273.1.62360 WP_003900273.1.62371 WP_003900273.1.62379 WP_003900273.1.62395 WP_003900273.1.62408 WP_003900273.1.62449 WP_003900273.1.62468 WP_003900273.1.62508 WP_003900273.1.62565 WP_003900273.1.62606 WP_003900273.1.62616 WP_003900273.1.62666 WP_003900273.1.62687 WP_003900273.1.62715 WP_003900273.1.62738 WP_003900273.1.62761 WP_003900273.1.62786 WP_003900273.1.62813 WP_003900273.1.62839 WP_003900273.1.62841 WP_003900273.1.62909 WP_003900273.1.6294 WP_003900273.1.6295 WP_003900273.1.62962 WP_003900273.1.63007 WP_003900273.1.63019 WP_003900273.1.63032 WP_003900273.1.63064 WP_003900273.1.63066 WP_003900273.1.63072 WP_003900273.1.6308 WP_003900273.1.63081 WP_003900273.1.63096 WP_003900273.1.63106 WP_003900273.1.6314 WP_003900273.1.63154 WP_003900273.1.63161 WP_003900273.1.63166 WP_003900273.1.63175 WP_003900273.1.6322 WP_003900273.1.63222 WP_003900273.1.63247 WP_003900273.1.6328 WP_003900273.1.63291 WP_003900273.1.63312 WP_003900273.1.63317 WP_003900273.1.63331 WP_003900273.1.63373 WP_003900273.1.63384 WP_003900273.1.63403 WP_003900273.1.63424 WP_003900273.1.63428 WP_003900273.1.63464 WP_003900273.1.63502 WP_003900273.1.63504 WP_003900273.1.63530 WP_003900273.1.63538 WP_003900273.1.63564 WP_003900273.1.63567 WP_003900273.1.63596 WP_003900273.1.63627 WP_003900273.1.63654 WP_003900273.1.63662 WP_003900273.1.63711 WP_003900273.1.63819 WP_003900273.1.63844 WP_003900273.1.63913 WP_003900273.1.63915 WP_003900273.1.63918 WP_003900273.1.63961 WP_003900273.1.64027 WP_003900273.1.64082 WP_003900273.1.64091 WP_003900273.1.64102 WP_003900273.1.64104 WP_003900273.1.64119 WP_003900273.1.64169 WP_003900273.1.64219 WP_003900273.1.6422 WP_003900273.1.64222 WP_003900273.1.64223 WP_003900273.1.64228 WP_003900273.1.6427 WP_003900273.1.64278 WP_003900273.1.64287 WP_003900273.1.64414 WP_003900273.1.64419 WP_003900273.1.6443 WP_003900273.1.64463 WP_003900273.1.64506 WP_003900273.1.64511 WP_003900273.1.64513 WP_003900273.1.64514 WP_003900273.1.64515 WP_003900273.1.64522 WP_003900273.1.64526 WP_003900273.1.64543 WP_003900273.1.6456 WP_003900273.1.64567 WP_003900273.1.64588 WP_003900273.1.64589 WP_003900273.1.64594 WP_003900273.1.64595 WP_003900273.1.64608 WP_003900273.1.64629 WP_003900273.1.6464 WP_003900273.1.64664 WP_003900273.1.64669 WP_003900273.1.64672 WP_003900273.1.64680 WP_003900273.1.64682 WP_003900273.1.64727 WP_003900273.1.64729 WP_003900273.1.64774 WP_003900273.1.64802 WP_003900273.1.6486 WP_003900273.1.64870 WP_003900273.1.64898 WP_003900273.1.64922 WP_003900273.1.64924 WP_003900273.1.6493 WP_003900273.1.64937 WP_003900273.1.64941 WP_003900273.1.64966 WP_003900273.1.64973 WP_003900273.1.65001 WP_003900273.1.65026 WP_003900273.1.65053 WP_003900273.1.65102 WP_003900273.1.65157 WP_003900273.1.65181 WP_003900273.1.65212 WP_003900273.1.65229 WP_003900273.1.6523 WP_003900273.1.65253 WP_003900273.1.65329 WP_003900273.1.6536 WP_003900273.1.65374 WP_003900273.1.65386 WP_003900273.1.65414 WP_003900273.1.65433 WP_003900273.1.65455 WP_003900273.1.65467 WP_003900273.1.65488 WP_003900273.1.65583 WP_003900273.1.65623 WP_003900273.1.65635 WP_003900273.1.65648 WP_003900273.1.65683 WP_003900273.1.65686 WP_003900273.1.65688 WP_003900273.1.65707 WP_003900273.1.65747 WP_003900273.1.65816 WP_003900273.1.65830 WP_003900273.1.65862 WP_003900273.1.65893 WP_003900273.1.65929 WP_003900273.1.65932 WP_003900273.1.65974 WP_003900273.1.66004 WP_003900273.1.66013 WP_003900273.1.66089 WP_003900273.1.66149 WP_003900273.1.66229 WP_003900273.1.66276 WP_003900273.1.66293 WP_003900273.1.66297 WP_003900273.1.66323 WP_003900273.1.66325 WP_003900273.1.66334 WP_003900273.1.66355 WP_003900273.1.66394 WP_003900273.1.66455 WP_003900273.1.66460 WP_003900273.1.66464 WP_003900273.1.66466 WP_003900273.1.66487 WP_003900273.1.66544 WP_003900273.1.66580 WP_003900273.1.66582 WP_003900273.1.66612 WP_003900273.1.66615 WP_003900273.1.66656 WP_003900273.1.66663 WP_003900273.1.66675 WP_003900273.1.66715 WP_003900273.1.66718 WP_003900273.1.66817 WP_003900273.1.66826 WP_003900273.1.66842 WP_003900273.1.66868 WP_003900273.1.66880 WP_003900273.1.66961 WP_003900273.1.67005 WP_003900273.1.6704 WP_003900273.1.67044 WP_003900273.1.67061 WP_003900273.1.67089 WP_003900273.1.67098 WP_003900273.1.67146 WP_003900273.1.67170 WP_003900273.1.67198 WP_003900273.1.6720 WP_003900273.1.67220 WP_003900273.1.67225 WP_003900273.1.67231 WP_003900273.1.6724 WP_003900273.1.67257 WP_003900273.1.67298 WP_003900273.1.67307 WP_003900273.1.67332 WP_003900273.1.67346 WP_003900273.1.67354 WP_003900273.1.67360 WP_003900273.1.67381 WP_003900273.1.67396 WP_003900273.1.67417 WP_003900273.1.67422 WP_003900273.1.67453 WP_003900273.1.67459 WP_003900273.1.6746 WP_003900273.1.67473 WP_003900273.1.67481 WP_003900273.1.67482 WP_003900273.1.67496 WP_003900273.1.67516 WP_003900273.1.67523 WP_003900273.1.67536 WP_003900273.1.67575 WP_003900273.1.67587 WP_003900273.1.67598 WP_003900273.1.67600 WP_003900273.1.67602 WP_003900273.1.67630 WP_003900273.1.67692 WP_003900273.1.67744 WP_003900273.1.6775 WP_003900273.1.67750 WP_003900273.1.6777 WP_003900273.1.67809 WP_003900273.1.67848 WP_003900273.1.67870 WP_003900273.1.67888 WP_003900273.1.67915 WP_003900273.1.67980 WP_003900273.1.67982 WP_003900273.1.68022 WP_003900273.1.68029 WP_003900273.1.68057 WP_003900273.1.68083 WP_003900273.1.68088 WP_003900273.1.68110 WP_003900273.1.68153 WP_003900273.1.68164 WP_003900273.1.68169 WP_003900273.1.68193 WP_003900273.1.68212 WP_003900273.1.68227 WP_003900273.1.6825 WP_003900273.1.68297 WP_003900273.1.68325 WP_003900273.1.68340 WP_003900273.1.68384 WP_003900273.1.68388 WP_003900273.1.68429 WP_003900273.1.6843 WP_003900273.1.68433 WP_003900273.1.68465 WP_003900273.1.68484 WP_003900273.1.68518 WP_003900273.1.68569 WP_003900273.1.68576 WP_003900273.1.68580 WP_003900273.1.68623 WP_003900273.1.68624 WP_003900273.1.68637 WP_003900273.1.68646 WP_003900273.1.68667 WP_003900273.1.68669 WP_003900273.1.68672 WP_003900273.1.68704 WP_003900273.1.68708 WP_003900273.1.6872 WP_003900273.1.68730 WP_003900273.1.68734 WP_003900273.1.68748 WP_003900273.1.68754 WP_003900273.1.6876 WP_003900273.1.68761 WP_003900273.1.68763 WP_003900273.1.68766 WP_003900273.1.68774 WP_003900273.1.68796 WP_003900273.1.68824 WP_003900273.1.68832 WP_003900273.1.68833 WP_003900273.1.68841 WP_003900273.1.68859 WP_003900273.1.68876 WP_003900273.1.68916 WP_003900273.1.68923 WP_003900273.1.68945 WP_003900273.1.6896 WP_003900273.1.68981 WP_003900273.1.68984 WP_003900273.1.69008 WP_003900273.1.69076 WP_003900273.1.69079 WP_003900273.1.69082 WP_003900273.1.69178 WP_003900273.1.69181 WP_003900273.1.69231 WP_003900273.1.69256 WP_003900273.1.69311 WP_003900273.1.69315 WP_003900273.1.69322 WP_003900273.1.69342 WP_003900273.1.6935 WP_003900273.1.6936 WP_003900273.1.69369 WP_003900273.1.69374 WP_003900273.1.69426 WP_003900273.1.69427 WP_003900273.1.69429 WP_003900273.1.6951 WP_003900273.1.69511 WP_003900273.1.69526 WP_003900273.1.69547 WP_003900273.1.69573 WP_003900273.1.6960 WP_003900273.1.69617 WP_003900273.1.69634 WP_003900273.1.69647 WP_003900273.1.69659 WP_003900273.1.69673 WP_003900273.1.69684 WP_003900273.1.69707 WP_003900273.1.69709 WP_003900273.1.69723 WP_003900273.1.69800 WP_003900273.1.69802 WP_003900273.1.69870 WP_003900273.1.69873 WP_003900273.1.69898 WP_003900273.1.69913 WP_003900273.1.69925 WP_003900273.1.69931 WP_003900273.1.69938 WP_003900273.1.69955 WP_003900273.1.69957 WP_003900273.1.69981 WP_003900273.1.69990 WP_003900273.1.70 WP_003900273.1.70032 WP_003900273.1.70062 WP_003900273.1.70072 WP_003900273.1.70131 WP_003900273.1.70132 WP_003900273.1.7022 WP_003900273.1.70227 WP_003900273.1.70274 WP_003900273.1.7029 WP_003900273.1.70325 WP_003900273.1.70328 WP_003900273.1.70356 WP_003900273.1.70369 WP_003900273.1.70418 WP_003900273.1.70422 WP_003900273.1.70435 WP_003900273.1.70463 WP_003900273.1.70480 WP_003900273.1.70494 WP_003900273.1.70498 WP_003900273.1.70505 WP_003900273.1.70525 WP_003900273.1.70573 WP_003900273.1.70577 WP_003900273.1.70610 WP_003900273.1.70615 WP_003900273.1.70618 WP_003900273.1.70622 WP_003900273.1.70626 WP_003900273.1.70704 WP_003900273.1.70729 WP_003900273.1.70782 WP_003900273.1.70796 WP_003900273.1.70830 WP_003900273.1.70840 WP_003900273.1.70871 WP_003900273.1.70915 WP_003900273.1.70955 WP_003900273.1.70958 WP_003900273.1.70964 WP_003900273.1.70976 WP_003900273.1.71026 WP_003900273.1.71063 WP_003900273.1.71076 WP_003900273.1.7111 WP_003900273.1.71118 WP_003900273.1.71128 WP_003900273.1.71187 WP_003900273.1.71255 WP_003900273.1.71258 WP_003900273.1.71259 WP_003900273.1.71289 WP_003900273.1.71326 WP_003900273.1.71329 WP_003900273.1.71331 WP_003900273.1.71344 WP_003900273.1.71390 WP_003900273.1.71440 WP_003900273.1.71457 WP_003900273.1.7146 WP_003900273.1.71492 WP_003900273.1.71509 WP_003900273.1.71516 WP_003900273.1.71517 WP_003900273.1.71527 WP_003900273.1.71532 WP_003900273.1.71545 WP_003900273.1.71546 WP_003900273.1.71569 WP_003900273.1.71604 WP_003900273.1.71621 WP_003900273.1.71630 WP_003900273.1.71638 WP_003900273.1.71654 WP_003900273.1.71664 WP_003900273.1.71683 WP_003900273.1.71718 WP_003900273.1.71781 WP_003900273.1.71820 WP_003900273.1.71847 WP_003900273.1.71871 WP_003900273.1.71909 WP_003900273.1.71957 WP_003900273.1.71970 WP_003900273.1.72047 WP_003900273.1.72061 WP_003900273.1.72062 WP_003900273.1.72111 WP_003900273.1.72122 WP_003900273.1.72128 WP_003900273.1.72143 WP_003900273.1.7216 WP_003900273.1.72209 WP_003900273.1.72218 WP_003900273.1.72219 WP_003900273.1.72227 WP_003900273.1.7224 WP_003900273.1.72332 WP_003900273.1.72380 WP_003900273.1.72405 WP_003900273.1.72420 WP_003900273.1.72451 WP_003900273.1.72452 WP_003900273.1.72457 WP_003900273.1.72459 WP_003900273.1.72466 WP_003900273.1.72487 WP_003900273.1.72488 WP_003900273.1.72506 WP_003900273.1.72543 WP_003900273.1.7256 WP_003900273.1.72585 WP_003900273.1.72591 WP_003900273.1.72592 WP_003900273.1.72640 WP_003900273.1.7266 WP_003900273.1.72661 WP_003900273.1.72739 WP_003900273.1.72744 WP_003900273.1.72755 WP_003900273.1.72759 WP_003900273.1.72784 WP_003900273.1.72792 WP_003900273.1.72826 WP_003900273.1.72831 WP_003900273.1.72852 WP_003900273.1.72879 WP_003900273.1.72880 WP_003900273.1.72954 WP_003900273.1.72957 WP_003900273.1.72959 WP_003900273.1.72973 WP_003900273.1.7298 WP_003900273.1.72982 WP_003900273.1.72988 WP_003900273.1.72993 WP_003900273.1.73028 WP_003900273.1.73042 WP_003900273.1.73045 WP_003900273.1.73092 WP_003900273.1.73118 WP_003900273.1.73127 WP_003900273.1.73134 WP_003900273.1.73150 WP_003900273.1.73163 WP_003900273.1.73205 WP_003900273.1.73310 WP_003900273.1.73365 WP_003900273.1.73391 WP_003900273.1.73404 WP_003900273.1.73424 WP_003900273.1.73445 WP_003900273.1.73453 WP_003900273.1.73465 WP_003900273.1.73466 WP_003900273.1.73471 WP_003900273.1.73478 WP_003900273.1.73482 WP_003900273.1.73507 WP_003900273.1.73532 WP_003900273.1.73550 WP_003900273.1.73564 WP_003900273.1.73623 WP_003900273.1.73644 WP_003900273.1.73688 WP_003900273.1.73744 WP_003900273.1.73750 WP_003900273.1.73760 WP_003900273.1.73774 WP_003900273.1.7379 WP_003900273.1.73813 WP_003900273.1.73840 WP_003900273.1.73876 WP_003900273.1.7389 WP_003900273.1.73986 WP_003900273.1.74016 WP_003900273.1.74039 WP_003900273.1.74083 WP_003900273.1.74101 WP_003900273.1.74107 WP_003900273.1.74120 WP_003900273.1.74144 WP_003900273.1.7417 WP_003900273.1.74190 WP_003900273.1.7423 WP_003900273.1.74259 WP_003900273.1.74262 WP_003900273.1.74269 WP_003900273.1.74291 WP_003900273.1.74296 WP_003900273.1.7436 WP_003900273.1.74378 WP_003900273.1.74382 WP_003900273.1.74395 WP_003900273.1.74400 WP_003900273.1.74401 WP_003900273.1.74432 WP_003900273.1.74477 WP_003900273.1.74487 WP_003900273.1.74504 WP_003900273.1.74551 WP_003900273.1.74555 WP_003900273.1.74628 WP_003900273.1.74641 WP_003900273.1.74653 WP_003900273.1.74660 WP_003900273.1.74820 WP_003900273.1.74870 WP_003900273.1.74881 WP_003900273.1.74888 WP_003900273.1.74952 WP_003900273.1.75043 WP_003900273.1.75045 WP_003900273.1.75055 WP_003900273.1.75078 WP_003900273.1.75081 WP_003900273.1.75120 WP_003900273.1.75163 WP_003900273.1.75188 WP_003900273.1.75200 WP_003900273.1.75202 WP_003900273.1.75239 WP_003900273.1.75250 WP_003900273.1.75263 WP_003900273.1.75281 WP_003900273.1.7535 WP_003900273.1.75376 WP_003900273.1.75391 WP_003900273.1.75441 WP_003900273.1.75581 WP_003900273.1.75635 WP_003900273.1.75645 WP_003900273.1.75665 WP_003900273.1.75741 WP_003900273.1.75772 WP_003900273.1.75774 WP_003900273.1.75833 WP_003900273.1.7585 WP_003900273.1.75864 WP_003900273.1.75868 WP_003900273.1.75968 WP_003900273.1.75974 WP_003900273.1.76007 WP_003900273.1.76016 WP_003900273.1.76032 WP_003900273.1.76037 WP_003900273.1.7604 WP_003900273.1.76064 WP_003900273.1.76110 WP_003900273.1.76133 WP_003900273.1.76172 WP_003900273.1.76177 WP_003900273.1.76183 WP_003900273.1.76209 WP_003900273.1.76272 WP_003900273.1.76277 WP_003900273.1.76280 WP_003900273.1.76281 WP_003900273.1.76291 WP_003900273.1.76297 WP_003900273.1.76360 WP_003900273.1.76379 WP_003900273.1.76403 WP_003900273.1.76413 WP_003900273.1.76414 WP_003900273.1.76427 WP_003900273.1.76436 WP_003900273.1.76442 WP_003900273.1.76443 WP_003900273.1.76456 WP_003900273.1.76521 WP_003900273.1.76533 WP_003900273.1.76625 WP_003900273.1.76629 WP_003900273.1.76635 WP_003900273.1.76638 WP_003900273.1.76639 WP_003900273.1.76678 WP_003900273.1.76679 WP_003900273.1.76750 WP_003900273.1.76754 WP_003900273.1.76781 WP_003900273.1.76818 WP_003900273.1.76824 WP_003900273.1.76835 WP_003900273.1.76873 WP_003900273.1.76881 WP_003900273.1.76900 WP_003900273.1.7691 WP_003900273.1.76947 WP_003900273.1.76954 WP_003900273.1.76955 WP_003900273.1.76976 WP_003900273.1.77000 WP_003900273.1.77021 WP_003900273.1.77056 WP_003900273.1.77065 WP_003900273.1.77075 WP_003900273.1.77093 WP_003900273.1.77107 WP_003900273.1.77115 WP_003900273.1.77118 WP_003900273.1.77141 WP_003900273.1.77142 WP_003900273.1.77166 WP_003900273.1.77250 WP_003900273.1.77252 WP_003900273.1.77260 WP_003900273.1.77266 WP_003900273.1.77280 WP_003900273.1.77285 WP_003900273.1.77312 WP_003900273.1.77348 WP_003900273.1.77351 WP_003900273.1.77352 WP_003900273.1.77361 WP_003900273.1.774 WP_003900273.1.7740 WP_003900273.1.77425 WP_003900273.1.77463 WP_003900273.1.7748 WP_003900273.1.77484 WP_003900273.1.77530 WP_003900273.1.77559 WP_003900273.1.77599 WP_003900273.1.77605 WP_003900273.1.7762 WP_003900273.1.77627 WP_003900273.1.77649 WP_003900273.1.77654 WP_003900273.1.77667 WP_003900273.1.77704 WP_003900273.1.77726 WP_003900273.1.77774 WP_003900273.1.7778 WP_003900273.1.77790 WP_003900273.1.77809 WP_003900273.1.77843 WP_003900273.1.77865 WP_003900273.1.77879 WP_003900273.1.77890 WP_003900273.1.77909 WP_003900273.1.77931 WP_003900273.1.77984 WP_003900273.1.78020 WP_003900273.1.78024 WP_003900273.1.78084 WP_003900273.1.78086 WP_003900273.1.7809 WP_003900273.1.78105 WP_003900273.1.78136 WP_003900273.1.78162 WP_003900273.1.7817 WP_003900273.1.78236 WP_003900273.1.78238 WP_003900273.1.78322 WP_003900273.1.78338 WP_003900273.1.7836 WP_003900273.1.78360 WP_003900273.1.78429 WP_003900273.1.78459 WP_003900273.1.78488 WP_003900273.1.7849 WP_003900273.1.78516 WP_003900273.1.78524 WP_003900273.1.78538 WP_003900273.1.78544 WP_003900273.1.78545 WP_003900273.1.78574 WP_003900273.1.78580 WP_003900273.1.7860 WP_003900273.1.78620 WP_003900273.1.78646 WP_003900273.1.78648 WP_003900273.1.78655 WP_003900273.1.78657 WP_003900273.1.78659 WP_003900273.1.7869 WP_003900273.1.78692 WP_003900273.1.78760 WP_003900273.1.78766 WP_003900273.1.78776 WP_003900273.1.78778 WP_003900273.1.78784 WP_003900273.1.78788 WP_003900273.1.78790 WP_003900273.1.78793 WP_003900273.1.78848 WP_003900273.1.78860 WP_003900273.1.7887 WP_003900273.1.78884 WP_003900273.1.78969 WP_003900273.1.78977 WP_003900273.1.79005 WP_003900273.1.79064 WP_003900273.1.79068 WP_003900273.1.79077 WP_003900273.1.79095 WP_003900273.1.79112 WP_003900273.1.79145 WP_003900273.1.79152 WP_003900273.1.79163 WP_003900273.1.79182 WP_003900273.1.79198 WP_003900273.1.79218 WP_003900273.1.79268 WP_003900273.1.79290 WP_003900273.1.79319 WP_003900273.1.79326 WP_003900273.1.79394 WP_003900273.1.79413 WP_003900273.1.79422 WP_003900273.1.79447 WP_003900273.1.79455 WP_003900273.1.79471 WP_003900273.1.79480 WP_003900273.1.79482 WP_003900273.1.79488 WP_003900273.1.79500 WP_003900273.1.79514 WP_003900273.1.79565 WP_003900273.1.79588 WP_003900273.1.79698 WP_003900273.1.797 WP_003900273.1.79744 WP_003900273.1.79784 WP_003900273.1.79802 WP_003900273.1.79806 WP_003900273.1.79819 WP_003900273.1.79828 WP_003900273.1.79851 WP_003900273.1.79853 WP_003900273.1.79881 WP_003900273.1.79898 WP_003900273.1.7990 WP_003900273.1.79913 WP_003900273.1.79918 WP_003900273.1.79947 WP_003900273.1.79948 WP_003900273.1.7995 WP_003900273.1.7997 WP_003900273.1.80004 WP_003900273.1.80015 WP_003900273.1.80054 WP_003900273.1.80084 WP_003900273.1.80234 WP_003900273.1.8026 WP_003900273.1.80275 WP_003900273.1.80299 WP_003900273.1.80300 WP_003900273.1.80326 WP_003900273.1.80351 WP_003900273.1.80370 WP_003900273.1.80399 WP_003900273.1.80451 WP_003900273.1.80458 WP_003900273.1.80461 WP_003900273.1.80490 WP_003900273.1.80503 WP_003900273.1.80552 WP_003900273.1.80576 WP_003900273.1.80588 WP_003900273.1.80599 WP_003900273.1.8060 WP_003900273.1.80624 WP_003900273.1.80636 WP_003900273.1.80669 WP_003900273.1.80673 WP_003900273.1.80711 WP_003900273.1.80714 WP_003900273.1.80815 WP_003900273.1.80853 WP_003900273.1.80918 WP_003900273.1.80967 WP_003900273.1.8097 WP_003900273.1.80988 WP_003900273.1.81013 WP_003900273.1.81059 WP_003900273.1.81066 WP_003900273.1.81075 WP_003900273.1.81091 WP_003900273.1.81136 WP_003900273.1.8114 WP_003900273.1.81189 WP_003900273.1.81192 WP_003900273.1.812 WP_003900273.1.81230 WP_003900273.1.81249 WP_003900273.1.81250 WP_003900273.1.81264 WP_003900273.1.8128 WP_003900273.1.81287 WP_003900273.1.81407 WP_003900273.1.8143 WP_003900273.1.81439 WP_003900273.1.81465 WP_003900273.1.81505 WP_003900273.1.81529 WP_003900273.1.81538 WP_003900273.1.81541 WP_003900273.1.81561 WP_003900273.1.81567 WP_003900273.1.81686 WP_003900273.1.81720 WP_003900273.1.81731 WP_003900273.1.81774 WP_003900273.1.81788 WP_003900273.1.81809 WP_003900273.1.81820 WP_003900273.1.81850 WP_003900273.1.81883 WP_003900273.1.81891 WP_003900273.1.82011 WP_003900273.1.82048 WP_003900273.1.82108 WP_003900273.1.82142 WP_003900273.1.8215 WP_003900273.1.8217 WP_003900273.1.82209 WP_003900273.1.82210 WP_003900273.1.82228 WP_003900273.1.82251 WP_003900273.1.82309 WP_003900273.1.82346 WP_003900273.1.82385 WP_003900273.1.82462 WP_003900273.1.82483 WP_003900273.1.82494 WP_003900273.1.82531 WP_003900273.1.82546 WP_003900273.1.82547 WP_003900273.1.82549 WP_003900273.1.82592 WP_003900273.1.82598 WP_003900273.1.82642 WP_003900273.1.82681 WP_003900273.1.8273 WP_003900273.1.82774 WP_003900273.1.82803 WP_003900273.1.82836 WP_003900273.1.82860 WP_003900273.1.82871 WP_003900273.1.82935 WP_003900273.1.82957 WP_003900273.1.82973 WP_003900273.1.82981 WP_003900273.1.82983 WP_003900273.1.83004 WP_003900273.1.83009 WP_003900273.1.83065 WP_003900273.1.83110 WP_003900273.1.83146 WP_003900273.1.83149 WP_003900273.1.83159 WP_003900273.1.83173 WP_003900273.1.83181 WP_003900273.1.83197 WP_003900273.1.83212 WP_003900273.1.83262 WP_003900273.1.83268 WP_003900273.1.83273 WP_003900273.1.83332 WP_003900273.1.83334 WP_003900273.1.83341 WP_003900273.1.83367 WP_003900273.1.83380 WP_003900273.1.83409 WP_003900273.1.83435 WP_003900273.1.83470 WP_003900273.1.83524 WP_003900273.1.83526 WP_003900273.1.8358 WP_003900273.1.83601 WP_003900273.1.83611 WP_003900273.1.83648 WP_003900273.1.83656 WP_003900273.1.83689 WP_003900273.1.83692 WP_003900273.1.83704 WP_003900273.1.83705 WP_003900273.1.83766 WP_003900273.1.83793 WP_003900273.1.83794 WP_003900273.1.83805 WP_003900273.1.83842 WP_003900273.1.83850 WP_003900273.1.83861 WP_003900273.1.83884 WP_003900273.1.83930 WP_003900273.1.83975 WP_003900273.1.84027 WP_003900273.1.8404 WP_003900273.1.84070 WP_003900273.1.8409 WP_003900273.1.8415 WP_003900273.1.84176 WP_003900273.1.84186 WP_003900273.1.84192 WP_003900273.1.84228 WP_003900273.1.84259 WP_003900273.1.8426 WP_003900273.1.84277 WP_003900273.1.84287 WP_003900273.1.8434 WP_003900273.1.84388 WP_003900273.1.84408 WP_003900273.1.84409 WP_003900273.1.84488 WP_003900273.1.84525 WP_003900273.1.84620 WP_003900273.1.84623 WP_003900273.1.84641 WP_003900273.1.84666 WP_003900273.1.84670 WP_003900273.1.84739 WP_003900273.1.84766 WP_003900273.1.84774 WP_003900273.1.84812 WP_003900273.1.84839 WP_003900273.1.84846 WP_003900273.1.84873 WP_003900273.1.84911 WP_003900273.1.84938 WP_003900273.1.84968 WP_003900273.1.84973 WP_003900273.1.84985 WP_003900273.1.85038 WP_003900273.1.8505 WP_003900273.1.85074 WP_003900273.1.8509 WP_003900273.1.8512 WP_003900273.1.85148 WP_003900273.1.8518 WP_003900273.1.8522 WP_003900273.1.85242 WP_003900273.1.85276 WP_003900273.1.85281 WP_003900273.1.85314 WP_003900273.1.85330 WP_003900273.1.85346 WP_003900273.1.8535 WP_003900273.1.85363 WP_003900273.1.85371 WP_003900273.1.85377 WP_003900273.1.85387 WP_003900273.1.85399 WP_003900273.1.85458 WP_003900273.1.85464 WP_003900273.1.85495 WP_003900273.1.85557 WP_003900273.1.85597 WP_003900273.1.85599 WP_003900273.1.85610 WP_003900273.1.8563 WP_003900273.1.85679 WP_003900273.1.85727 WP_003900273.1.85737 WP_003900273.1.85763 WP_003900273.1.85819 WP_003900273.1.85820 WP_003900273.1.85823 WP_003900273.1.85832 WP_003900273.1.85872 WP_003900273.1.85894 WP_003900273.1.85909 WP_003900273.1.86000 WP_003900273.1.86024 WP_003900273.1.86067 WP_003900273.1.86103 WP_003900273.1.86160 WP_003900273.1.86164 WP_003900273.1.86168 WP_003900273.1.86190 WP_003900273.1.86204 WP_003900273.1.86208 WP_003900273.1.86235 WP_003900273.1.86260 WP_003900273.1.86290 WP_003900273.1.863 WP_003900273.1.86327 WP_003900273.1.86337 WP_003900273.1.86377 WP_003900273.1.86425 WP_003900273.1.86459 WP_003900273.1.8649 WP_003900273.1.86520 WP_003900273.1.86568 WP_003900273.1.86575 WP_003900273.1.86584 WP_003900273.1.86605 WP_003900273.1.86626 WP_003900273.1.86648 WP_003900273.1.8666 WP_003900273.1.86684 WP_003900273.1.86696 WP_003900273.1.86705 WP_003900273.1.86725 WP_003900273.1.86757 WP_003900273.1.86766 WP_003900273.1.86801 WP_003900273.1.86814 WP_003900273.1.86825 WP_003900273.1.86834 WP_003900273.1.86855 WP_003900273.1.86877 WP_003900273.1.86883 WP_003900273.1.8689 WP_003900273.1.86933 WP_003900273.1.86950 WP_003900273.1.86962 WP_003900273.1.86979 WP_003900273.1.87001 WP_003900273.1.87031 WP_003900273.1.87117 WP_003900273.1.87162 WP_003900273.1.87178 WP_003900273.1.87191 WP_003900273.1.87201 WP_003900273.1.87209 WP_003900273.1.87240 WP_003900273.1.87266 WP_003900273.1.87273 WP_003900273.1.8733 WP_003900273.1.87345 WP_003900273.1.87369 WP_003900273.1.8737 WP_003900273.1.87404 WP_003900273.1.87406 WP_003900273.1.87444 WP_003900273.1.87446 WP_003900273.1.87472 WP_003900273.1.87489 WP_003900273.1.87496 WP_003900273.1.87582 WP_003900273.1.87588 WP_003900273.1.87617 WP_003900273.1.87619 WP_003900273.1.87620 WP_003900273.1.87643 WP_003900273.1.8765 WP_003900273.1.87650 WP_003900273.1.87654 WP_003900273.1.87665 WP_003900273.1.87676 WP_003900273.1.87677 WP_003900273.1.87684 WP_003900273.1.87692 WP_003900273.1.87707 WP_003900273.1.87784 WP_003900273.1.87796 WP_003900273.1.87817 WP_003900273.1.87835 WP_003900273.1.87837 WP_003900273.1.87911 WP_003900273.1.87924 WP_003900273.1.87951 WP_003900273.1.87955 WP_003900273.1.87956 WP_003900273.1.87991 WP_003900273.1.88 WP_003900273.1.88002 WP_003900273.1.88037 WP_003900273.1.88072 WP_003900273.1.88077 WP_003900273.1.88121 WP_003900273.1.88180 WP_003900273.1.88191 WP_003900273.1.88217 WP_003900273.1.88245 WP_003900273.1.88253 WP_003900273.1.88294 WP_003900273.1.88316 WP_003900273.1.88320 WP_003900273.1.88338 WP_003900273.1.88453 WP_003900273.1.88469 WP_003900273.1.88507 WP_003900273.1.88521 WP_003900273.1.88530 WP_003900273.1.88541 WP_003900273.1.88618 WP_003900273.1.8862 WP_003900273.1.88632 WP_003900273.1.88634 WP_003900273.1.88649 WP_003900273.1.88756 WP_003900273.1.88824 WP_003900273.1.88985 WP_003900273.1.8902 WP_003900273.1.89025 WP_003900273.1.89041 WP_003900273.1.89046 WP_003900273.1.89082 WP_003900273.1.89168 WP_003900273.1.89193 WP_003900273.1.89205 WP_003900273.1.89207 WP_003900273.1.8925 WP_003900273.1.89277 WP_003900273.1.89286 WP_003900273.1.89320 WP_003900273.1.8935 WP_003900273.1.89371 WP_003900273.1.89378 WP_003900273.1.89406 WP_003900273.1.8943 WP_003900273.1.89451 WP_003900273.1.89453 WP_003900273.1.89473 WP_003900273.1.89475 WP_003900273.1.89483 WP_003900273.1.895 WP_003900273.1.89513 WP_003900273.1.89517 WP_003900273.1.89522 WP_003900273.1.8954 WP_003900273.1.89543 WP_003900273.1.89567 WP_003900273.1.8957 WP_003900273.1.89572 WP_003900273.1.89589 WP_003900273.1.89607 WP_003900273.1.89625 WP_003900273.1.89648 WP_003900273.1.8967 WP_003900273.1.89670 WP_003900273.1.89676 WP_003900273.1.89729 WP_003900273.1.89739 WP_003900273.1.8977 WP_003900273.1.89802 WP_003900273.1.89808 WP_003900273.1.8982 WP_003900273.1.89844 WP_003900273.1.89849 WP_003900273.1.89901 WP_003900273.1.89903 WP_003900273.1.89909 WP_003900273.1.8992 WP_003900273.1.89926 WP_003900273.1.89971 WP_003900273.1.89987 WP_003900273.1.900 WP_003900273.1.9007 WP_003900273.1.90080 WP_003900273.1.90134 WP_003900273.1.90137 WP_003900273.1.90199 WP_003900273.1.90245 WP_003900273.1.90308 WP_003900273.1.90322 WP_003900273.1.90328 WP_003900273.1.90439 WP_003900273.1.90481 WP_003900273.1.90527 WP_003900273.1.90550 WP_003900273.1.90560 WP_003900273.1.90640 WP_003900273.1.90672 WP_003900273.1.90687 WP_003900273.1.90691 WP_003900273.1.90711 WP_003900273.1.90744 WP_003900273.1.9075 WP_003900273.1.90756 WP_003900273.1.90785 WP_003900273.1.90788 WP_003900273.1.90800 WP_003900273.1.90810 WP_003900273.1.90819 WP_003900273.1.9082 WP_003900273.1.90831 WP_003900273.1.90884 WP_003900273.1.90906 WP_003900273.1.90958 WP_003900273.1.90976 WP_003900273.1.90987 WP_003900273.1.9102 WP_003900273.1.91026 WP_003900273.1.91032 WP_003900273.1.91043 WP_003900273.1.91082 WP_003900273.1.91106 WP_003900273.1.91112 WP_003900273.1.91144 WP_003900273.1.91151 WP_003900273.1.91157 WP_003900273.1.91167 WP_003900273.1.91169 WP_003900273.1.91192 WP_003900273.1.91201 WP_003900273.1.91207 WP_003900273.1.91208 WP_003900273.1.91211 WP_003900273.1.91214 WP_003900273.1.91230 WP_003900273.1.91244 WP_003900273.1.91260 WP_003900273.1.91265 WP_003900273.1.9128 WP_003900273.1.91284 WP_003900273.1.91294 WP_003900273.1.91303 WP_003900273.1.91352 WP_003900273.1.91386 WP_003900273.1.9139 WP_003900273.1.91398 WP_003900273.1.91411 WP_003900273.1.91430 WP_003900273.1.91436 WP_003900273.1.91483 WP_003900273.1.91496 WP_003900273.1.91507 WP_003900273.1.91508 WP_003900273.1.91576 WP_003900273.1.91589 WP_003900273.1.91695 WP_003900273.1.91713 WP_003900273.1.91717 WP_003900273.1.91728 WP_003900273.1.91759 WP_003900273.1.91785 WP_003900273.1.91786 WP_003900273.1.91802 WP_003900273.1.91822 WP_003900273.1.91828 WP_003900273.1.9189 WP_003900273.1.9190 WP_003900273.1.91915 WP_003900273.1.91931 WP_003900273.1.91944 WP_003900273.1.91953 WP_003900273.1.91957 WP_003900273.1.91976 WP_003900273.1.91978 WP_003900273.1.92021 WP_003900273.1.92190 WP_003900273.1.92192 WP_003900273.1.92200 WP_003900273.1.92220 WP_003900273.1.92222 WP_003900273.1.92273 WP_003900273.1.92289 WP_003900273.1.9229 WP_003900273.1.92294 WP_003900273.1.92300 WP_003900273.1.92317 WP_003900273.1.92334 WP_003900273.1.92338 WP_003900273.1.92345 WP_003900273.1.92356 WP_003900273.1.92380 WP_003900273.1.92416 WP_003900273.1.92456 WP_003900273.1.92508 WP_003900273.1.9251 WP_003900273.1.92511 WP_003900273.1.92527 WP_003900273.1.92536 WP_003900273.1.92592 WP_003900273.1.92603 WP_003900273.1.92606 WP_003900273.1.9263 WP_003900273.1.92650 WP_003900273.1.92660 WP_003900273.1.92690 WP_003900273.1.92706 WP_003900273.1.92714 WP_003900273.1.92760 WP_003900273.1.92777 WP_003900273.1.92833 WP_003900273.1.92881 WP_003900273.1.92892 WP_003900273.1.92908 WP_003900273.1.9291 WP_003900273.1.92917 WP_003900273.1.93008 WP_003900273.1.93009 WP_003900273.1.9307 WP_003900273.1.93083 WP_003900273.1.93097 WP_003900273.1.93192 WP_003900273.1.93199 WP_003900273.1.93203 WP_003900273.1.93212 WP_003900273.1.93234 WP_003900273.1.93245 WP_003900273.1.93265 WP_003900273.1.93297 WP_003900273.1.93320 WP_003900273.1.93328 WP_003900273.1.93363 WP_003900273.1.93417 WP_003900273.1.93426 WP_003900273.1.9344 WP_003900273.1.93447 WP_003900273.1.93470 WP_003900273.1.93483 WP_003900273.1.93487 WP_003900273.1.93495 WP_003900273.1.93516 WP_003900273.1.93536 WP_003900273.1.93555 WP_003900273.1.93560 WP_003900273.1.9357 WP_003900273.1.93573 WP_003900273.1.93576 WP_003900273.1.93588 WP_003900273.1.93645 WP_003900273.1.93649 WP_003900273.1.93677 WP_003900273.1.9368 WP_003900273.1.93698 WP_003900273.1.93706 WP_003900273.1.9371 WP_003900273.1.93792 WP_003900273.1.93871 WP_003900273.1.9388 WP_003900273.1.93913 WP_003900273.1.93946 WP_003900273.1.93950 WP_003900273.1.93953 WP_003900273.1.93954 WP_003900273.1.93988 WP_003900273.1.9407 WP_003900273.1.94143 WP_003900273.1.94154 WP_003900273.1.94184 WP_003900273.1.94204 WP_003900273.1.94256 WP_003900273.1.94261 WP_003900273.1.94281 WP_003900273.1.94297 WP_003900273.1.9431 WP_003900273.1.94339 WP_003900273.1.94392 WP_003900273.1.94416 WP_003900273.1.94456 WP_003900273.1.94470 WP_003900273.1.94480 WP_003900273.1.94495 WP_003900273.1.94512 WP_003900273.1.94525 WP_003900273.1.94528 WP_003900273.1.94564 WP_003900273.1.946 WP_003900273.1.94602 WP_003900273.1.94623 WP_003900273.1.94629 WP_003900273.1.94714 WP_003900273.1.94730 WP_003900273.1.94736 WP_003900273.1.9478 WP_003900273.1.94834 WP_003900273.1.94852 WP_003900273.1.94872 WP_003900273.1.9488 WP_003900273.1.94902 WP_003900273.1.94916 WP_003900273.1.94996 WP_003900273.1.94998 WP_003900273.1.95007 WP_003900273.1.95010 WP_003900273.1.95068 WP_003900273.1.95081 WP_003900273.1.95082 WP_003900273.1.9509 WP_003900273.1.95096 WP_003900273.1.95112 WP_003900273.1.95138 WP_003900273.1.95188 WP_003900273.1.95234 WP_003900273.1.95241 WP_003900273.1.95245 WP_003900273.1.95257 WP_003900273.1.95279 WP_003900273.1.9531 WP_003900273.1.95335 WP_003900273.1.95344 WP_003900273.1.9535 WP_003900273.1.95370 WP_003900273.1.95392 WP_003900273.1.95416 WP_003900273.1.95417 WP_003900273.1.95491 WP_003900273.1.95497 WP_003900273.1.95508 WP_003900273.1.95509 WP_003900273.1.95529 WP_003900273.1.95556 WP_003900273.1.95557 WP_003900273.1.95565 WP_003900273.1.95578 WP_003900273.1.95580 WP_003900273.1.95585 WP_003900273.1.95643 WP_003900273.1.95679 WP_003900273.1.95685 WP_003900273.1.957 WP_003900273.1.95724 WP_003900273.1.95730 WP_003900273.1.95735 WP_003900273.1.95772 WP_003900273.1.95839 WP_003900273.1.9585 WP_003900273.1.95902 WP_003900273.1.95908 WP_003900273.1.95924 WP_003900273.1.95926 WP_003900273.1.95953 WP_003900273.1.95958 WP_003900273.1.95964 WP_003900273.1.96006 WP_003900273.1.9602 WP_003900273.1.96036 WP_003900273.1.96065 WP_003900273.1.96098 WP_003900273.1.96146 WP_003900273.1.96166 WP_003900273.1.96171 WP_003900273.1.96182 WP_003900273.1.96204 WP_003900273.1.96230 WP_003900273.1.96235 WP_003900273.1.96242 WP_003900273.1.96245 WP_003900273.1.96254 WP_003900273.1.96259 WP_003900273.1.96286 WP_003900273.1.96313 WP_003900273.1.96318 WP_003900273.1.96345 WP_003900273.1.96360 WP_003900273.1.96373 WP_003900273.1.96456 WP_003900273.1.96560 WP_003900273.1.96575 WP_003900273.1.96576 WP_003900273.1.96621 WP_003900273.1.9667 WP_003900273.1.96681 WP_003900273.1.96726 WP_003900273.1.96733 WP_003900273.1.96742 WP_003900273.1.96754 WP_003900273.1.9678 WP_003900273.1.97008 WP_003900273.1.97009 WP_003900273.1.97084 WP_003900273.1.97087 WP_003900273.1.97094 WP_003900273.1.97099 WP_003900273.1.97113 WP_003900273.1.97122 WP_003900273.1.97127 WP_003900273.1.97136 WP_003900273.1.97223 WP_003900273.1.97237 WP_003900273.1.97242 WP_003900273.1.97270 WP_003900273.1.97283 WP_003900273.1.97296 WP_003900273.1.97321 WP_003900273.1.97325 WP_003900273.1.97330 WP_003900273.1.97376 WP_003900273.1.97380 WP_003900273.1.9739 WP_003900273.1.97462 WP_003900273.1.97517 WP_003900273.1.97519 WP_003900273.1.97535 WP_003900273.1.97545 WP_003900273.1.97546 WP_003900273.1.97568 WP_003900273.1.97591 WP_003900273.1.97596 WP_003900273.1.97609 WP_003900273.1.97618 WP_003900273.1.9763 WP_003900273.1.97669 WP_003900273.1.97673 WP_003900273.1.97700 WP_003900273.1.97701 WP_003900273.1.97730 WP_003900273.1.97740 WP_003900273.1.97751 WP_003900273.1.97754 WP_003900273.1.9784 WP_003900273.1.97888 WP_003900273.1.9790 WP_003900273.1.9795 WP_003900273.1.97951 WP_003900273.1.97958 WP_003900273.1.97966 WP_003900273.1.97977 WP_003900273.1.98018 WP_003900273.1.98052 WP_003900273.1.98071 WP_003900273.1.98072 WP_003900273.1.98113 WP_003900273.1.98114 WP_003900273.1.98181 WP_003900273.1.98188 WP_003900273.1.98189 WP_003900273.1.98213 WP_003900273.1.98291 WP_003900273.1.98335 WP_003900273.1.98412 WP_003900273.1.98441 WP_003900273.1.98443 WP_003900273.1.98462 WP_003900273.1.9848 WP_003900273.1.98482 WP_003900273.1.98486 WP_003900273.1.98488 WP_003900273.1.98503 WP_003900273.1.98516 WP_003900273.1.98524 WP_003900273.1.98536 WP_003900273.1.98541 WP_003900273.1.98566 WP_003900273.1.98594 WP_003900273.1.98599 WP_003900273.1.98645 WP_003900273.1.98646 WP_003900273.1.98656 WP_003900273.1.98674 WP_003900273.1.98697 WP_003900273.1.98701 WP_003900273.1.98749 WP_003900273.1.98765 WP_003900273.1.98770 WP_003900273.1.98777 WP_003900273.1.98778 WP_003900273.1.98802 WP_003900273.1.98838 WP_003900273.1.98850 WP_003900273.1.98935 WP_003900273.1.98948 WP_003900273.1.98984 WP_003900273.1.99000 WP_003900273.1.99023 WP_003900273.1.99030 WP_003900273.1.99037 WP_003900273.1.99055 WP_003900273.1.99062 WP_003900273.1.99086 WP_003900273.1.99115 WP_003900273.1.99117 WP_003900273.1.99161 WP_003900273.1.99176 WP_003900273.1.99205 WP_003900273.1.99216 WP_003900273.1.99222 WP_003900273.1.99269 WP_003900273.1.99294 WP_003900273.1.99312 WP_003900273.1.99315 WP_003900273.1.99322 WP_003900273.1.99328 WP_003900273.1.99365 WP_003900273.1.99379 WP_003900273.1.99396 WP_003900273.1.99402 WP_003900273.1.99404 WP_003900273.1.99419 WP_003900273.1.99438 WP_003900273.1.99460 WP_003900273.1.99468 WP_003900273.1.99473 WP_003900273.1.99513 WP_003900273.1.99529 WP_003900273.1.99548 WP_003900273.1.99572 WP_003900273.1.99575 WP_003900273.1.99609 WP_003900273.1.99617 WP_003900273.1.99635 WP_003900273.1.99650 WP_003900273.1.99672 WP_003900273.1.99711 WP_003900273.1.99716 WP_003900273.1.99740 WP_003900273.1.99745 WP_003900273.1.99749 WP_003900273.1.9976 WP_003900273.1.99798 WP_003900273.1.99832 WP_003900273.1.99847 WP_003900273.1.99852 WP_003900273.1.99897 WP_003900273.1.99915 WP_003900273.1.9993 WP_003900273.1.99982 WP_003900273.1.99991 Rv1090 gi|525673845|ref|YP_008225197.1| gi|148660876|ref|YP_001282399.1| gi|392433318|ref|YP_006474362.1| gi|253799871|ref|YP_003032872.1| gi|121637021|ref|YP_977244.1| gi|479055049|ref|YP_007350855.1| gi|197739815|ref|YP_002161129.1| gi|224989494|ref|YP_002644181.1| gi|378770855|ref|YP_005170588.1| gi|15608230|ref|NP_215606.1| gi|385997873|ref|YP_005916171.1| gi|31792283|ref|NP_854776.1| gi|494695497|ref|YP_007961000.1| gi|386004093|ref|YP_005922372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]