SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_0701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  234267.Acid_0701
Domain Number - Region: 67-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0131
Family Laminin G-like module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_0701
Sequence length 212
Comment (Solibacter usitatus Ellin6076)
Sequence
MYKIAIALLLTLPFGFAADEAGFTPLFDGKTLNGWKLVGGHGPGYVVQEGKIVCPADGGG
NLFTEKEFGNFAFRFEFKLTPGANNGIGIRAPYEGDAAYQGMEIQILDDGDKVYQGKIRP
EQYHGSVYDVIPARTGYRKPVGEWNEEEIVADGRRIKVTLNGVIILDADLSIVKEPQVLA
HHPGLARTAGHIGFLGHGSLVEFRNIRVKPLP
Download sequence
Identical sequences Q02B64
WP_011682478.1.46729 gi|116619831|ref|YP_821987.1| 234267.Acid_0701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]