SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_2120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_2120
Domain Number 1 Region: 41-370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-145
Family Alpha-L-arabinofuranosidase B, N-terminal domain 0.0000000261
Further Details:      
 
Domain Number 2 Region: 488-598
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.00000000536
Family Lamin A/C globular tail domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_2120
Sequence length 1140
Comment (Solibacter usitatus Ellin6076)
Sequence
MRPRINLVLMPALALTLIGAALTMAQQDGAGRNAPPPRPKGPCDIYAAAGDPCVAAHSTT
RALYAGYNGPLYQVLRQSDGKTLDIGVVQPAASPLQDAGGYANAAAQDAFCANTYCWVSI
IFDQSPKHNDVIHAPRGGFSGPSMGGFNNLPVADMAPITIMGHKAYGVFITPGMGLRQND
AKGTAVDDQAEGQYWVINGHHYNSGCCFDYGNAEIDSRDDDNGTMETTYYGNATSWYHGN
PAGPWIMTDQENNLVGCVNPDGTKLCASLPNITWRFVTAMAKGEPHHWTSMGGDAQHGAL
KVMFDGPRVDVTYDPMRKQGAILLGNGGDNSVGSQGTFYEGAMTAADTFPSDATDQLVQA
NVVAARYDLPRLSLAPASATAAPPGLQTFSPGSSQNTTLTFTNTTGAPVVGVQLSLSVPR
QWTSVVTGASTTSATIAGPVAPGASVSATFKVTSGPVAFNGDLVGNARFTNQATGAKQFE
TTSEKVRNVSPVKINEFRITDGSPTNSTNSFIELYNAGARDVDISNWTLTQHPAQQAIFS
AVKIPARTKLTPGGFYLLGLANSGLAVPARAGDKTIHVRSTAGMNVGDTISIESGSGAET
HKIVNVGTAAGAGTTLWQPLPDGPVIKLPAGSTNVPVTSVAGFAAGEKIAIGYGAVYPAV
ARTIEQYEVATVTAVGKPGTQAFLGVDAAAGATNIKVTSVANISAGDRIRLDIESVGHGI
ETVAVTKVGTQSSRTALSADAHAGATNIKVRNANGFTVGDKLTVGTPANHETVTITAVAD
GVDFTPALAKAHLNREFVVAQGTGLDLAAPLKFNHAANLPFSVKGTGISLQGETAFAHSS
NEPVQPLGTGITLDAPLAKDHAINAVVRDAQVTIAGYQGTPVPNQWFGGPALAPGAGNMV
LRDAAGLVVDSLNYGLLVDPWASEGYQATSGAGQGGCRVPAPSPAGGFGAAAAAAVSPNR
SAGRFPDGADSDSNCTDFLLQPATTLPFGSSAGATNIKVAGVADFAAGQTILIGTGADRE
TAVIATVGTAGATMSGGDIEAGATVIPVAAGFGFAPNQTITIDSGANQESAVVVAAGGGR
GGARITVAAPLTHAHPAGAQISGTGITLTAALTKAHAGGTQVSSDLPTPGAPNKYSNARR
Download sequence
Identical sequences Q026F9
WP_011683883.1.46729 gi|116621239|ref|YP_823395.1| 234267.Acid_2120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]