SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_2572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_2572
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Ribosomal protein S16 6.93e-27
Family Ribosomal protein S16 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_2572
Sequence length 81
Comment (Solibacter usitatus Ellin6076)
Sequence
MIRLARFGAKKKPFYRIVVIEKERARNGRNLEVVGHYNPLTTPPQVMLKHERVEHWTKSG
AQMSDTVKRLVEKNPAAQPVA
Download sequence
Identical sequences Q024L5
gi|116621690|ref|YP_823846.1| WP_011684329.1.46729 234267.Acid_2572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]