SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_4708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  234267.Acid_4708
Domain Number - Region: 58-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00211
Family Laminin G-like module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_4708
Sequence length 209
Comment (Solibacter usitatus Ellin6076)
Sequence
MKTLGWLVLFGFAATTGRVVTFDTSALGQTPPEWTVAMTNRGRAPHWEVVRDQTAPTQPY
VFAQTAADRVGDRFPLAILNGVTMRDGDVSVRLKPVSGHDVRAGGVVWHYRDPNNYYLAR
ANAVDKNVQVFKVENGRRIPLIAGAKHEIPTNGWSIIKVSVKGNRYQVYMDHRRILQGWD
NTFPTTGGVGLWTVGDSITYFDDFRVTPK
Download sequence
Identical sequences Q01XE8
234267.Acid_4708 gi|116623796|ref|YP_825952.1| WP_011686419.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]