SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_5395 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  234267.Acid_5395
Domain Number - Region: 30-86
Classification Level Classification E-value
Superfamily Flavoproteins 0.00277
Family NADPH-dependent FMN reductase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_5395
Sequence length 195
Comment (Solibacter usitatus Ellin6076)
Sequence
MKRLLWNGIALAAVVVMFYVAFLSLRIEQQSVREEAQPADVILVLGAAEYRGRPSPVLRA
RLDHALDLYSRKFAPRILTTGGSGGDPIFTEGGVGRSYLTQHGVPSDAIIVETEGESTVE
STTMAAEIMRRMELHSVIVVSDGYHIYRVKQMLEAHGMTAYGSPRPDHSQSPLHLRWNYL
KQAFGYLLWTIGVKV
Download sequence
Identical sequences Q01VH1
WP_011687085.1.46729 234267.Acid_5395 gi|116624473|ref|YP_826629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]