SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_5761 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_5761
Domain Number 1 Region: 36-210
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.97e-35
Family YkgG-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_5761
Sequence length 211
Comment (Solibacter usitatus Ellin6076)
Sequence
MSRDNILHKVRTALGRSAGQAVAPPPPVRLRIPEVPMEARIESFITRLEVLAGKAVRVGT
MEEACQFVALAIAGKTAAASNAPYLAECGITGLPGVRSGIRDLAELREVCATVDIGITSA
DYMLGDTGTLVTIASPAEARLMSLLPPAHLAVVPKERMLTGLDELFTVVPHPAEITSSMV
LITGPSRTADIEQILVRGVHGPGNVTVVIVG
Download sequence
Identical sequences Q01UG2
gi|116624837|ref|YP_826993.1| WP_011687443.1.46729 234267.Acid_5761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]