SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_7424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_7424
Domain Number 1 Region: 5-121
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.1e-31
Family Multidomain sulfurtransferase (rhodanese) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_7424
Sequence length 121
Comment (Solibacter usitatus Ellin6076)
Sequence
MMHSPGFLKLVTEAKSRVKEIDLGAYQEMREAGEPHLLVDTREDNEWAAGHVAGAVHLSK
GIIERDIEGKVPDKDTKLILYCGGGFRSALVADNLRQMGYTNAISLDGGWRALKESGLPL
E
Download sequence
Identical sequences Q01PT8
234267.Acid_7424 gi|116626461|ref|YP_828617.1| WP_011689047.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]