SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234621.RER_23760 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234621.RER_23760
Domain Number 1 Region: 91-206
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 3.27e-16
Family Glycerol-3-phosphate (1)-acyltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 234621.RER_23760
Sequence length 299
Comment (Rhodococcus erythropolis PR4)
Sequence
MTATVPYWVPTSPCGDGCLPTDAPGVSSITVMARGVMVGAALVTAPVLSAGWLLPRTWRT
EMQRGYSRALLRCLGMKLTVDDQRLGRAEPAGVMVVAGHVSWTDVLVASAVAPANFVARA
DLLDWAVLGGLARRMRVVPIDRARLRELPGTVDVVRERLQRGVRVMVFPEGTTWCGRAYG
GFRPAMFQAAVDAECPVQPMAIRYENADGSLCTGPCFVGTETIGQSIRRILRQKNVEVKV
RLAPLEEAGECRVDLAQRCERAVRGVETIDLAAHDIFDPAPELVTQAVGQIDTSPAMTA
Download sequence
Identical sequences A0A0E4A5X2 A0A0U3ITE2 A0A2A5J818 C0ZXJ9 U0E9E3
234621.RER_23760 WP_020907246.1.2937 WP_020907246.1.38104 WP_020907246.1.58082 WP_020907246.1.61491 WP_020907246.1.78616 WP_020907246.1.79292 WP_020907246.1.83724 WP_020907246.1.98030 gi|226305863|ref|YP_002765823.1| gi|532364413|ref|YP_008452812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]