SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234621.RER_39180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234621.RER_39180
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily L28p-like 3.92e-25
Family Ribosomal protein L31p 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 234621.RER_39180
Sequence length 78
Comment (Rhodococcus erythropolis PR4)
Sequence
MKAGIHPTYVATTVVCGCGNTFETHSTKESGRINVEVCSQCHPFYTGKQKILDTGGRVAR
FEARYGKRADSKVPATES
Download sequence
Identical sequences A0A069JBV0 A0A0C3A8Q2 A0A0U3B6E2 A0A2A5J3R5 C1A1Z1 C3JI50
gi|532365790|ref|YP_008454189.1| WP_003941310.1.101405 WP_003941310.1.10702 WP_003941310.1.17328 WP_003941310.1.23831 WP_003941310.1.26240 WP_003941310.1.2937 WP_003941310.1.3260 WP_003941310.1.3298 WP_003941310.1.3447 WP_003941310.1.37275 WP_003941310.1.38104 WP_003941310.1.38653 WP_003941310.1.40047 WP_003941310.1.428 WP_003941310.1.51229 WP_003941310.1.54495 WP_003941310.1.55320 WP_003941310.1.57831 WP_003941310.1.58082 WP_003941310.1.58299 WP_003941310.1.60401 WP_003941310.1.61491 WP_003941310.1.61677 WP_003941310.1.66626 WP_003941310.1.69155 WP_003941310.1.69306 WP_003941310.1.77150 WP_003941310.1.78616 WP_003941310.1.79292 WP_003941310.1.81178 WP_003941310.1.82590 WP_003941310.1.83342 WP_003941310.1.83724 WP_003941310.1.85181 WP_003941310.1.88476 WP_003941310.1.88663 WP_003941310.1.92716 WP_003941310.1.95272 WP_003941310.1.98030 234621.RER_39180 gi|226307405|ref|YP_002767365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]