SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234621.RER_45050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  234621.RER_45050
Domain Number - Region: 14-106
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00316
Family Cytochrome c3-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234621.RER_45050
Sequence length 143
Comment (Rhodococcus erythropolis PR4)
Sequence
MTWKNTQTRTSTAEAKRWARAVKARDRFKCVTCGYQGTDGKGDVQADHRQPVAEGGQQYD
LANGQTLCTPCHKTKTAEETARGLARTGRKLPPEQHPGTITPPTSHAETPTVQPKHTYAM
PWDDPSRSTTDPRISAYGPTGKP
Download sequence
Identical sequences C0ZMF5
WP_020908696.1.2937 gi|226307992|ref|YP_002767952.1| 234621.RER_45050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]