SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235279.HH0215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235279.HH0215
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.04e-33
Family Cytochrome c3-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 235279.HH0215
Sequence length 168
Comment (Helicobacter hepaticus)
Sequence
MKQDRQKRPTLMSSIFAILLIAIVIIACYTFWHAKGASYLSNDSEACNNCHIMNEVYSDY
LSAPHSQKIAGQPRATCNDCHLPHNFVSKWIAKAQSGVGHAYAFTFKLDTLPTNLSANET
SKQMVQNNCVRCHIEYVQNAVNPTTTPGHNNALNCVSCHESAGHKRGF
Download sequence
Identical sequences A0A099BK82 Q7VJM8
gi|32265714|ref|NP_859746.1| WP_011115059.1.5593 WP_011115059.1.84735 235279.HH0215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]