SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235279.HH0641 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235279.HH0641
Domain Number 1 Region: 55-241
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.67e-45
Family Pseudouridine synthase RsuA/RluD 0.00057
Further Details:      
 
Weak hits

Sequence:  235279.HH0641
Domain Number - Region: 8-69
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00032
Family Ribosomal protein S4 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235279.HH0641
Sequence length 245
Comment (Helicobacter hepaticus)
Sequence
MYKDKAYKVLARTHNISHNQAKSLIDKGLVFAAGKKVNIARLEIPIHTAFEILKPKKPKV
LFTDEHILALEKPPFIESYDLSNMFEGWHLLHRLDRETSGVILLIKEGSAFHIKAKEAFK
NQEVYKEYVCLVHGILADSIEINKAISTTKRGFAKSRIDKKGLNALTLLTPLSIMGKKTL
LKALIKTGRTHQIRVHCQSINHPILGDRIYGKNDEAKRLMLHAHKIALLGYEFTSPLPKE
LRIGE
Download sequence
Identical sequences A0A099BSK1 Q7VIG5
gi|32266140|ref|NP_860172.1| 235279.HH0641 WP_011115483.1.5593 WP_011115483.1.84735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]