SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235279.HH0834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  235279.HH0834
Domain Number - Region: 44-102
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000562
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235279.HH0834
Sequence length 168
Comment (Helicobacter hepaticus)
Sequence
MNKLFDGVLAVLVVLVMSGLLVWVIISIADGIAEDEDSYSFTSTHQGHYKDGKREGKWSI
NNNYRLDNGNDGRDEIEGSYVQGLRDGKWKVKTPYKRCIYEYNKGVIRKEICINNYYTFT
HKIFNEWGDMIVKKEGSREKCKVLYSYFEKLYSDFENVESIYGLDECS
Download sequence
Identical sequences Q7VHX8
235279.HH0834 WP_011115674.1.84735 gi|32266333|ref|NP_860365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]