SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235279.HH1570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235279.HH1570
Domain Number 1 Region: 12-90
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.28e-16
Family Ferredoxin domains from multidomain proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 235279.HH1570
Sequence length 103
Comment (Helicobacter hepaticus)
Sequence
MGIKKAPQNVPVWVDETRCKACDVCVSLCPSGVLGMRKDEHKVLGKIISVAYPESCIGCR
ECELHCPDFAIFVADKEEFKFAKVSKEAQERAAKIKENKFMVI
Download sequence
Identical sequences A0A099BTB4 Q7VFV5
gi|32267069|ref|NP_861101.1| WP_011116410.1.5593 WP_011116410.1.84735 235279.HH1570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]