SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235909.GK3071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK3071
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.12e-85
Family Histidine biosynthesis enzymes 0.0000000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GK3071
Sequence length 252
Comment (Geobacillus kaustophilus HTA426)
Sequence
MITKRIIPCLDVKDGRVVKGVQFVQLRDAGDPVELAKAYDEQGADELVFLDISASHEGRK
TMVDVVERVAAQLAIPFTVGGGIHSLEDMKRMLRAGADKVSLNTAAVLHPTLITEGADFF
GSQCIVVAIDAKYDETLGSWRVYTHGGRNATNWEVVAWAQEAVRLGAGEILLTSMDADGG
KNGFDIELTRRVSEAVPVPVIASGGAGKAEHFLEAFEKGKADAALAASIFHYKETSVGQV
KAYLKEKGVNVR
Download sequence
Identical sequences A0A1D7NF12 A0A2H5KJE7 Q5KVD0 T0P2K8 U2X6V4 V6VKT1
WP_011232541.1.100150 WP_011232541.1.2219 WP_011232541.1.25743 WP_011232541.1.6497 WP_011232541.1.90668 WP_011232541.1.93593 235909.GK3071 gi|56421606|ref|YP_148924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]