SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235909.GKP05 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GKP05
Domain Number 1 Region: 28-275
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.26e-53
Family Pce catalytic domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GKP05
Sequence length 281
Comment (Geobacillus kaustophilus HTA426)
Sequence
MRKIKMLMVAVIVFMIAILPGIVTDAAPKNMYVHFINVGQGDSIYIKAPNGEDILIDGGN
KDGSDVVAYLKKQKVKDIEIMIATHPDADHIGGLDEVLKAFPVKSVYAPKVGNTTQAYKD
FLVAVKNKKLTIKVAKADVVLPIKGVTAKFVGPVKSYSTSDTNDWSAVLKVTYGKKSFLF
TGDAETRAEADMVKAKKDLRADVLKVGHHGAKTSTSATLLKAAKPTYAVISVGKNAYGHP
TSEVLNRLKSYKVKVFRTDKQGTIIATTNGTTLTFNVKPIY
Download sequence
Identical sequences A0A150N1Z0 Q5QL62 V6V9S2
WP_011229479.1.13458 WP_011229479.1.2219 WP_011229479.1.22874 WP_011229479.1.25743 235909.GKP05 gi|56410442|ref|YP_145816.1| gi|56410442|ref|YP_145816.1|NC_006509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]