SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CE54 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CE54
Domain Number 1 Region: 196-280
Classification Level Classification E-value
Superfamily PUG domain-like 4.05e-24
Family PUG domain 0.0015
Further Details:      
 
Domain Number 2 Region: 15-72
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000264
Family UBA domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CE54
Sequence length 299
Comment (Cryptosporidium hominis)
Sequence
MTDTEKLTNISDNCDDIKNYVDKNLLNSLMEMGFGQVESEKAIFFTRNKGLENAVTWLEE
NSKDDSIKEPIIEISGSDSIPGAPKLTDEEALEKAKELQRRARELRIQREKEEEIEKEKR
RIASTKQLLEAQRKLEEAERIRNIEKAAKEKNAHEVERQRQLSLLKEEWEERFGCPYPEE
KTNEVPKGNKEKVAYYCNRMNKEYRSKDLQGIMTCFNLLKTYINNVHSHPYEEKYKRIRL
KNPTFESKVLKYQGSLEILMACGFVKDSNEEFLVIPPEKIPDTFVCSQAIKFLTLLTQN
Download sequence
Identical sequences A0A0S4TEL8
237895.Q5CE54 XP_665114.1.74355 Chro.30445 gi|67585587|ref|XP_665114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]