SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CE76 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CE76
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000855
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000035
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CE76
Sequence length 531
Comment (Cryptosporidium hominis)
Sequence
MNLCSQFGNIVDISINNESHCVTYENRESLERALNSLQNLQISSEGDFIHAYIHQTSNTM
IGGLERSMNLVQNKWSHDFNQLNFPNIKEMCGSINFVDNIGIFGNTTTSASTSCRSNTEI
SASGASTTTNTSTNSPWNSFDSTITTYERNLWTAWLQDNKSNQNNSISKSILNEKCENSN
IIQDKIEENDELINQEKSKIKQNANGEFQNTNTNTTNNNSNNNNCNINKGQLSNPISNAS
SLNNNRTNTITYSSIVGSNLNKNNLVKGISQNSNAQNNENSVICTNNSVGNKPNIQDINA
FKLTKIIGKLDELNSDTVEMKNSGNLPPIITSNQSPTSTSSSSSSVSSPSAISTSCQNSS
SMLKKYTARYEIQIPPDNQFQIARRIIGTRGINMKRIFKLTQSKLRLRGKGSGYLEGYNK
QEADEPLHLCISSTNSEQYINARKLVERLLLKIYQEYDDFLLSNNDDHKTLNLQLKFKET
MRTKQLPTNQPNGNNSNNNHNNNNNINNNNAILSGVESNTNDDDLLNEFNF
Download sequence
Identical sequences 237895.Q5CE76 gi|67585683|ref|XP_665138.1| Chro.40027 XP_665138.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]