SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CF71 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CF71
Domain Number 1 Region: 48-97
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000317
Family SPRY domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CF71
Sequence length 120
Comment (Cryptosporidium hominis)
Sequence
MTENSVKIESHSKKETISHLNESASRSNPRKKSRKNTGKDNKVDNFDSPVFSVRYKDPSI
ELSEDRLTAVGYKGWSTVLLTHGASSGVWYFEITVLEPRVISKFLGHSKFLNLKQDPSIR
Download sequence
Identical sequences XP_665484.1.74355 Chro.10092 gi|67590451|ref|XP_665484.1| 237895.Q5CF71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]