SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CH09 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CH09
Domain Number 1 Region: 105-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 24-96
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CH09
Sequence length 364
Comment (Cryptosporidium hominis)
Sequence
MVNSSNMERTNYINIQNEEEQIIFVKLLISDKAANRILSNSGSILKKIKQVNHVFILVSG
ANKYFPGTNYRVATLEGNEKNVNETMEVLDFLLKNNKDDGQEGLKNYEYNIRLAVPRSVI
GSIIGIKGEFISHVRTATNAHINISPIFVTSEKACNERIITISGSNSNQVIHAFIILTKK
VNSSPEGRSCKSVIYRRADFFRRKNHKTEHEKVDPLLSSQLEEMKNVLNENPINSAYEVE
SRSLEIKEKPKLNFKTTSKGRWSEQVDLLAREEDKSLEKLGSELKQVKIIQKGLIEGAQI
NISQKTELANDDNKMQENLAEKLYEAPSKTVQERIPTNLFIISFLALITGAFFLQYISSE
VIRV
Download sequence
Identical sequences A0A0S4TJG2
237895.Q5CH09 XP_666123.1.74355 Chro.70085 gi|67597106|ref|XP_666123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]