SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CJ75 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CJ75
Domain Number 1 Region: 117-208
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CJ75
Sequence length 212
Comment (Cryptosporidium hominis)
Sequence
MGETKSMDMDMVEERRTEGPFKPLTGTEVNRSNEIRRVMVPENRMTPLKNQWINIVTPLV
EHMGLHVRMNTKRRCVELKYGPDCTDIGSLQKGVDFIKAFLLGFELQDAIALLRLDDLYI
ESFEIKDVKRLNGAHLSRCIGRISGRDGKTKYAIENSTRTRIVLAGQKLHLMGAFHNIKL
ARDALCSLILGTPPGKVYNHLRIVSKRVQEKL
Download sequence
Identical sequences A0A0S4TJZ2
gi|67608568|ref|XP_666887.1| XP_666887.1.74355 Chro.80193 237895.Q5CJ75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]