SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_0366 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_0366
Domain Number 1 Region: 97-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000309
Family Clostridium neurotoxins, the second last domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_0366
Sequence length 277
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MGRQLILSGADFSAGGLSLNWRPSMLGANLAAWLKADAGVTSSAGAVSQLLGQSTNAYAL
VQTTSAEQPALTANEQNNLPGIASSSATAQVLATATAPAAVQFEYNKPFSLLLAFKRVGA
SPYNGNNSWEAIMSCMDPAAAFRGWFVGGSKPSGGTFTFALSYNGAQAYAINVHGATVLA
AGHPYIATVTYDGSGHAAGVSITLNGAAETMTTVNDTLGTNTAVSSGQRLAILGGSNAIA
GFQSIDSFLEGVVVNRVLSAQEIAYAQEYLKGRWAAY
Download sequence
Identical sequences C1F9Z0
gi|225872054|ref|YP_002753509.1| WP_012680766.1.62785 240015.ACP_0366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]