SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_2088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_2088
Domain Number 1 Region: 8-117
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.72e-35
Family Chaperone J-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 269-355
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.45e-23
Family HSP40/DnaJ peptide-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 145-222
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.83e-19
Family DnaJ/Hsp40 cysteine-rich domain 0.00022
Further Details:      
 
Domain Number 4 Region: 125-149,211-272
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.14e-18
Family HSP40/DnaJ peptide-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_2088
Sequence length 383
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MSRTANVTKLDYYEVLGVERTANDQELKTAYRKLALQYHPDRNPGNPEAEEQFKACSEAY
QVLSDPQKRAAYDRFGHAGVNGGGPAAGGFDGSPFGGFEDLGDIFGDLFGFNVGGRGSRG
GNSRVQKGRDVRCDLTLAFEEAVFGKETHVTIHRREACGDCNGTGAAAGRGPVTCGQCQG
RGQVRYQQGFFSIARTCSACGGSGQVISDPCPTCRGDGRVDKQRNIAVHVPAGVEDGTRI
RYQGEGDVGRFGGPAGDLYVVLSVQPHKFFERDGNDLHCAIPISFPQASLGTELTLPSLD
GEVRLKIPEGTQSGKEFRVRGKGVPHLNEHGRGDLIVQIVVQTPTKLSKVQKELMRQLSD
SLTVENTPTSRSSLFEKVKEIFS
Download sequence
Identical sequences C1F925
WP_015897189.1.62785 240015.ACP_2088 gi|225873684|ref|YP_002755143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]