SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_2741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_2741
Domain Number 1 Region: 1-305
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-114
Family Alpha-L-arabinofuranosidase B, N-terminal domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 428-504
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.00000000144
Family Lamin A/C globular tail domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_2741
Sequence length 1080
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MYASYDGPLYQVRRQSDGKFLNIGVVQPSASSGSGSGYADAVAQDQFCANTFCWISRIYD
QSPKHNDLTQAPRGGWSGPALGGMDNLPLANMAPVMVMGHKVYGVFIEPGMGMRDDDPRG
TAVDDQAEGEYWVVNGKHFNSGCCYDFGNAEIDSRDDDAGTMETAYFGDAPYWYHGNPPG
PWVMTDQENNLVGCVNADGSNHCPQLPNIQWRFVTAIAKGEPHHWTSMGGDAQHGPLQVM
FSGPRVDWQYDPMRKQGAILLGNGGDNSNGSQGTFYEGAMTAAGTFPSNATDQQLQANIV
SAHYRALPVSIAPSSATAAPTGLQTFSPHSSQSTTVTFTNTSDVPATKVTLSLALPDRQW
SAVVAGSSRHSAVFAGPVAHGASVSATFKVTSGSKLLNADLTGTARWTDAASHRQHTVSR
VEKVRNVLPVRINEFRIGSNSPANDTNSFIELYNASSRSIDLSHWTLTAHPSQQAIFSSV
KIPAGTTLAAGHYYLIGLANSGLAAPARAGSRTLYVRSITGMKAGDHIEIGAGDHSETRT
IAQLGTAAGIPTRLWQPLPDGPSITIPAGATNVPVQRTDGFVVGQKIALGYGSTYPSAPM
GRERYEVATVTAVGKPGTQAYLATDAAAGSTHLKVTSVQNITAGDKIRLDIDSSGHGIET
VTVTKVGTAAIRARLMKAANAGATQINTFGAKGIAAGHQLIIATPAHQQTVTVTAVDDST
PMAAHITFHPALRQTFPKGAQVIDPGTGLELAAPLKFNHAANLPFSDRGTGISFEPATTV
AHISNDPIQALGTGIILNQPLASNHAIHAVVRDAADTTAGYQGAPAPDQWFGGPALTTQS
PLFGRIITVRQGSLVLRDAQGLVADSLNYGGLVDPWAAEGYQGASGLGKDGCYAPTPDSG
VSTGRYPNGVDTDSNCTDFVTAPVTIMPMATPAGARTIKITSTDGFAPGQTVHIGTGANL
ENAVIAKIGTPGATTVRTAVSSGATIVPVANVQAFHQGQTISIGSGANQESAVIAGAYGF
GPPILRLKSPLTHAHAAGAPVTGSGITLTAPLAQQHAPGTQMAGSSPTPGAANHYTRPIH
Download sequence
Identical sequences C1F349
240015.ACP_2741 gi|225874302|ref|YP_002755761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]