SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_1882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_1882
Domain Number 1 Region: 31-426
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.43e-56
Family Pectate transeliminase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_1882
Sequence length 428
Comment (Anabaena variabilis ATCC 29413)
Sequence
MTKNPVRNICLVVVTALTFTAVSSGEIGKAQISGKTYYVDQGTGSDYNSGTTQTSAFKTI
NKANQIVAAGDTIYVKNGTYQENITVKKSGTPDKWISLQAYPGQTPKVRGTQDGSISVEG
SYVKVIGFDVTSSGEGSAINVGRGNHHVHIIRNIVHDSGCGGISAQETDYLTIEENISYR
NAFRSGYMCSGISIYQAKAFDDAPGFHNIIRGNISYANENKVTTSWGGRSFVTDGNGIII
DDFRQTQSQRFRPRYTPWTLIENNIVFNNGGRGIHIYESDNVVVRNNTAFKNLRSGNLDG
HLNGELTTYFSSNIHFYNNIAYSSSLNKKTFVDDYSSKNRWDNNLSYIGSTLVNDGHSDV
KLGANNRINVNPLFINASTDPKLANFRLNLGSPAIDSGTTQSAASVDFDKNARPFGVGPD
MGAFELRR
Download sequence
Identical sequences Q3MBY2
240292.Ava_1882 gi|75908103|ref|YP_322399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]