SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_2798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_2798
Domain Number 1 Region: 184-234
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000497
Family Acyl-carrier protein (ACP) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_2798
Sequence length 238
Comment (Anabaena variabilis ATCC 29413)
Sequence
MRNTLDDIEKAISNTRKAIANLTAQQNQCQNQYTETKIVSQSAHDEALKAAYDGDSSLAI
KALSQEVIQEKIATLLHSQIKEQLTIIELLNNNLSILNNIKFALVKCLQNEPSQNNNTQS
LAANSRREHTGKDLYSNEFSSEDLLIERVKKVISEKESIEVENISLVHSLVLGGTFGSFL
SSSTNYDIPPNDLNMDNLDAIELLMAIEEEFDIEISDAEAEMVRTVQELVNIILFKLS
Download sequence
Identical sequences Q3M9C5
gi|75909010|ref|YP_323306.1| 240292.Ava_2798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]