SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_3695 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_3695
Domain Number 1 Region: 4-383
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.72e-97
Family AAT-like 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_3695
Sequence length 391
Comment (Anabaena variabilis ATCC 29413)
Sequence
MTNFTSRMQAVQSPIIPVVGELIQNSPGTISLGQGVVSYSPPPEAIELLPKFLADPANNL
YKAVEGIPPLLNALTDKLSTFNKMEITTDNCIVVTAGSNMAFMNAILAITSPGDEIILNT
PYYFNHEMAIAMAGCRAVLVETDENYQLRPEAIAQAITPKTRAVVTISPNNPTGVVYCED
LLRNVNQICANCGIYHISDEAYEYFTYDGVKHVSPASFAGSSEYTISLYSLSKAYGFASW
RIGYMVIPKHLLVAIKKVQDTILICPPVVSQYAALGALQAKPEYLQDHIQAIAQVRKIVF
DYLNQLQGLCTITPADGAFYVFLKVHTQIDAFTLVKQLIQEYKVAVIPGTTFGMESGCYL
RVAYGALQKDTVQEGIERLVQGLKTILYPEK
Download sequence
Identical sequences A0A1W5CLQ1 Q3M6T5
240292.Ava_3695 gi|75909900|ref|YP_324196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]