SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4357
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Ribosomal protein S16 2.35e-27
Family Ribosomal protein S16 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4357
Sequence length 86
Comment (Anabaena variabilis ATCC 29413)
Sequence
MIKLRLKRFGKKREASYRIVAMNNLSRRDGRPLEELGYYNPRTDEVRLDVPGIVKRLQQG
AQPTDTVRRILQKQNVFEQVSAKPAS
Download sequence
Identical sequences A0A1W5CQU0 A0A1Z4KEZ4 Q3M4Y1 Q8YVM2
103690.asr1953 240292.Ava_4357 gi|17229445|ref|NP_485993.1| gi|75910554|ref|YP_324850.1| WP_010996117.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]