SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4675 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4675
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.57e-80
Family D-ribulose-5-phosphate 3-epimerase 0.000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4675
Sequence length 235
Comment (Anabaena variabilis ATCC 29413)
Sequence
MTQNRSEKPIVISPSILSADFSRLGDEIRAVDAAGADWIHVDVMDGRFVPNITIGPLVVE
AIRPVTKKPLDVHLMIVEPEKYVEDFAKAGADIISVHCEHNASPHLHRTLGQIKELGKQA
GVVLNPGTPLELIEYVLELCDLILIMSVNPGFGGQSFIPGVVPKIRKLRQMCDERGLDPW
IEVDGGLKANNTWQVLEAGANAIVAGSAVFNAKDYAEAITNIRNSKRPTPELAKV
Download sequence
Identical sequences A0A1W5CB16 Q3M414
gi|75910871|ref|YP_325167.1| 240292.Ava_4675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]