SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_B0334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  240292.Ava_B0334
Domain Number - Region: 26-110
Classification Level Classification E-value
Superfamily Acid proteases 0.0278
Family Pepsin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_B0334
Sequence length 126
Comment (Anabaena variabilis ATCC 29413)
Sequence
MINGRLIAGRATVPVIFRLPGQPDFSLDFVIDTGFNGYITLPPQAVSAMNLPLHSTIPAI
LADGSQVLSSIHLATIVWDNVEKVVFVLASANKPLLGTGMMNGYHLGIDFEDNGLVSLEK
IPSSMS
Download sequence
Identical sequences A0A1W5CCZ4 A0A1Z4KUY3 Q3M1U2 Q8YKD6
gi|62946461|ref|YP_227665.1|NC_003276 gi|75812614|ref|YP_320233.1|NC_007410 WP_010999913.1.33676 gi|75812614|ref|YP_320233.1| 103690.all7364 240292.Ava_B0334 gi|62946461|ref|YP_227665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]