SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB11260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB11260
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000000000106
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.01
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000884
Family Prokaryotic DksA/TraR C4-type zinc finger 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243090.RB11260
Sequence length 121
Comment (Pirellula sp)
Sequence
MTRNDLIRSLVNKLQRRAAEIQEMVRTEFAELQHVSDHTVGDAGDRGIESHASELTSRMA
ESESRELADIEEALERLRDGTFGDCEDCGKSIPMNRLQVVPHARRCVRCQKASENSQLMA
V
Download sequence
Identical sequences Q7UEL7
243090.RB11260 NP_869875.1.48053 gi|32476881|ref|NP_869875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]