SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB1178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB1178
Domain Number 1 Region: 13-54
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000912
Family Lambda integrase-like, catalytic core 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243090.RB1178
Sequence length 71
Comment (Pirellula sp)
Sequence
MGFSGWKPKPHGLLLWQGTDIRQIQQLLGHNDVKTTEIDTHVRNPNEAKVVSLLDRLVRD
EVAVAGCARAD
Download sequence
Identical sequences Q7UXR0
243090.RB1178 NP_864264.1.48053 gi|32471271|ref|NP_864264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]