SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB12416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243090.RB12416
Domain Number - Region: 157-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00565
Family Laminin G-like module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243090.RB12416
Sequence length 292
Comment (Pirellula sp)
Sequence
MLSRGQWASTTIHLLKVSIVRRQSTPSINLASIPASRAFFAALVLALVPSSAFCQSAETP
PTAAKGAPAAEKAGHSDVKWRPLSEKWEDAHFGGDGEVTRENWKKKPEGTAEKRPGDGRL
FRLGMGDPLTGIRWAGEFPKENYELRLQARRTDGFDFFAAVTFPVGKEHCSFVLGGWGGG
VVGISSIDGNDASSNETTGYKDFKNKQWYNIRMRVDEENVTVWIDDSEWSSVNRSEHTFD
IRIEMDPCLPVGIANFQCESEVRGIEIRSLASATRDDASAKGTTEAKAAGNP
Download sequence
Identical sequences Q7UIP1
243090.RB12416 NP_870496.1.48053 gi|32477502|ref|NP_870496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]