SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB1281 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243090.RB1281
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily RNI-like 0.0188
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243090.RB1281
Sequence length 230
Comment (Pirellula sp)
Sequence
MGSRNGTPLGCTWQLELERAGLRRTGRCTRVVELSLLKWCVVHGRHVIVARANRIKLTTR
RSLAIVGVFAIIFAVPVSLHRRVTQEDIVIHEIESDNAVVIAIAEASTAPKHSGGYHILI
YGRFPENVAGSAWRRNVTPKPLRFLPQVIQSYCFASITSVRLDCNLCDSSALDHLHKLSN
LKSLEIIGGNPDSDAIERLKARFPGISIVDLSSFWSPLGTRKKNGAEPGV
Download sequence
Identical sequences Q7UXJ8
NP_864329.1.48053 gi|32471336|ref|NP_864329.1| 243090.RB1281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]