SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB1789 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB1789
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.91e-27
Family FHA domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243090.RB1789
Sequence length 243
Comment (Pirellula sp)
Sequence
MQVRLRVQSGSHEGKEIEVSDKRFLIGRSESCQLRPKSESVSRRHCILAIKDGRVLVQDL
KSRNGTFVNDKRLPADKAKVLKDGDLLRVGKLMFSLVIEHGLQAPKKPEVKDIADAAART
KKTAGEDSRFEEVDVDSWLDEADAIDRVRKQTDPDTRQFRLDAKEGENSDDLSVDGTVMI
EDVPAKKQNNDTKMSSDDDTSTGSRVIPPKSKPGKLPEGAKKALKENSRDAADDALKRFF
SGR
Download sequence
Identical sequences F2APG7 K5C7W0 L7CKC7 Q7UWU2
NP_864589.1.48053 WP_007325534.1.68031 WP_007325534.1.82120 WP_007325534.1.98447 gi|32471596|ref|NP_864589.1| 243090.RB1789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]