SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB2088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB2088
Domain Number 1 Region: 371-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000122
Family Leech intramolecular trans-sialidase, N-terminal domain 0.043
Further Details:      
 
Weak hits

Sequence:  243090.RB2088
Domain Number - Region: 35-46,73-193,231-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0389
Family Legume lectins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB2088
Sequence length 421
Comment (Pirellula sp)
Sequence
MQRIIFVLIAAFTSAMSDGTLSAFDPPLNRDVVRSTPGLVAFWDFDLRESSGNERFIAHV
PSGSSDNYPLDAANYVRDYWGEGRQATYADFPLLNDGPFGQAIRIREESDPNFRPFLFIP
RSRLHDTPLDIKGDGKSVTVVVWAIRESGNHALAGIWHEGTDLKQSSTASIKKVERGQRQ
YALFAGLNKPGSACGHVSENGASSFLNKYALHKCNSLGQSPAVAADSSPEKLAASWQCFA
MTFDNENNEITGWLNGISGERWLMNPKSNNLLSYAHNAYLQGHYARTPGTQEGEDSDFPK
AQYYNPPEGEASEVEVLREDENQRVERRRYRYTEVVVTLEKDGVGEWGETGRDLVGLRLN
PWWYPHGIYSPPDAEQGGPFTIGRVIHSSRSVGFTGWIGGVSVFDRALSEAELKTLADLR
N
Download sequence
Identical sequences Q7UWE6
NP_864735.1.48053 gi|32471742|ref|NP_864735.1| 243090.RB2088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]