SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB2125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB2125
Domain Number 1 Region: 94-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000169
Family Laminin G-like module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB2125
Sequence length 228
Comment (Pirellula sp)
Sequence
MRPLFANVLSAALAASTLSAYSPLVSAEDTRPAKVVFQDDFESGDDKWEYLDPKTWKLNT
PSGESKNGSIEITDRKSEYTPPTRSPGHVALVKDLEVGSFEIQFRVRSTLDTGNHRDCCV
FFGYQDSAHFYYVHLGAKPDPHSGQIMIVNDAPRLALTTNEKLTPWDNDWHNVLLRRDIE
NGKIEIYFDDMETPHMSVVDKTFGAGRVGLGSFDDLNEFDDVVIRKLQ
Download sequence
Identical sequences Q7UWC4
NP_864757.1.48053 gi|32471764|ref|NP_864757.1| 243090.RB2125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]