SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB2842 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB2842
Domain Number 1 Region: 377-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.29e-27
Family Clostridium neurotoxins, the second last domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243090.RB2842
Sequence length 574
Comment (Pirellula sp)
Sequence
MSEQKREQDFDQQLSHLLDGELTEAEVDRLAKSLATDETLRRRFCDQVEMDEGLAIVVRE
DRAGERFSQLLEQRLDAESQKFDFLHGVLDRSSLNTARNQLQRWAPLAAVAIAACLMVAF
LIGMWAGQKSGSRNAESVAKRISVPAPATDSEPVDASVALLKRTVNVEWQDDSALRMGDS
VSANETLDLKSGWVQLQFFRGATLTLEGPAKLEIRDPNLVVLHEGNAWASVPVPARGFTV
LTSETKIVDLGTEFGVSASIDGRTEVHVFDGLVELHDPSVRDDTASLRELVTGQSISVDG
NGNAVSNEQQVAKMPSESFLQPDREEAWQQRIERWESWSTKIRNDPRVLMYYDFASPAET
SSNASPTILPNLASGKKNADGSIIGCAWSEGRWPGKSALDFKRPSDRVRFHLDGEYKSIT
LAAWVRVDGLDRLLSSLLLTDGWDEGEVHWQFDRSGQLGLSVGQVPGVAWRYTPPLVDLT
TLGQWIHVASVFDGSTQTVRHYFNGRRVPCEGDLRYDGPIRIGDAELCNWGRPVDQNSHA
IRNFNGRMDEFLMLSDALDEAEIMEIYHAGNPTF
Download sequence
Identical sequences Q7UV67
NP_865175.1.48053 gi|32472181|ref|NP_865175.1| 243090.RB2842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]