SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB3804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB3804
Domain Number 1 Region: 94-289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-19
Family Clostridium neurotoxins, the second last domain 0.097
Further Details:      
 
Domain Number 2 Region: 587-678
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000357
Family monodomain cytochrome c 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB3804
Sequence length 1262
Comment (Pirellula sp)
Sequence
MFSFGITTRACDHAWSRRNSHRCCIYVASFAALISAPLFSALALAQQTSQNEVVTALDFT
KLESNTTSPLEIHVHGSVKWNVPGPVPPEYAEAKPGNLSAQFHGKGERLVIDDPGSDSQW
DFDNGDELSIQAIVKIDEIGEGQNVYVIGKGRTHEKKYASNNQNWALRLRQLNGSSRISL
LFATPEVSGNTPWHRWTSSEGVESTATWNHIAVTYRFGEPKSVRAWLNGKPVAGKWDMGG
PTKQAPIIDDAPVWVGSSMGGQHSSSFRGWIDQLIVSRKLLHDDDLKGCWNPPPPPRPKP
PEMLLSPGKVTWWWKDDIPTHTKWPVVNSDDGDSLTVEAPMLLSRLPQKYDSHGIRDSYS
KAVYLRLGTELSIPAGDHRFLVRARGLSRLWMNDEEIATIGPQNGRTDGHNPVEPLPERP
GPGLRRLAYGVQETIVEHSVKEEGDKRFILETIVGGTRYRAEPDETIVAVQLSGTGPFYL
LSSAFEDVNSRLPITDAMVETKLAQVETTLNAHDVHTRRHHAAAHNDYWDERHARANEWI
DSLESVEVPTNSTKAEQARHSIDRFLTAKIETYRRDARSSEAEPETNKLSLKAQSILRER
CFRCHDEDSEGGLQLSSAEAIRMGGDSGETLLVSGDPHAGELMRRIRSTDELERMPPSES
IPDEEIAILSRWISEGASWADEANTIEIADAELVDDESFIRRVYLDSIGVPPTETQFRVF
AADTAKDKRQRLIEDLMGQDAVADHWVSFWQDLLAENPNLLKPSLNNTGPFRFFLHDSLI
DNKPIDRMATELLMLHGSRYEGGSAGFGMAADNDAPEATRCIVAASAFMGMNLQCARCHD
SPYHSTTQEDLYSLAAMLARKELKVPASSSVPAAFFEDHPGRASLIQVTLPPGEAVEPNW
PFGDLVDTSRLDRWMREPSDARERLAVAVTTPENPRFAKVIVNRVWQRLIGTGFVEPLGD
WEKASPSHPELLEWLSRDFIASGYDFRKLVRTVMQSEVYQREAIGQNDPVNPANRFFAAP
DRRRMSSEQIIDSMVMSSGRPLDVEPLTFDPEARRPPQTMIHLDAPERAWEFTTLSNERD
RPSLAFPRAGVIVDVMKTFGWTGSRQSAIDRRDEDPNVLQPGAVGNSVFASWTVAASEDS
ELADLAVQSETPDSLTESLFVRFLSRRPTDDERELFANVLSDGFDDRIVPKAHRHRAEPL
PELEHVSWSNHLADRANSIKLELEQRAVRGDAPDSRLRSTWRQSYEDVIWSLLNSPEFIW
IP
Download sequence
Identical sequences Q7UTM0
243090.RB3804 gi|32472737|ref|NP_865731.1| NYSGXRC-10062i NP_865731.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]